Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07480 183 / 7e-58 KUOX1 KAR-UP oxidoreductase 1 (.1) AT3G60290 153 / 4e-46 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G44800 144 / 1e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 132 / 8e-38 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17010 108 / 1e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 107 / 2e-28 ATSRG1, SRG1 senescence-related gene 1 (.1) AT4G10490 103 / 5e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G20400 103 / 7e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 103 / 9e-27 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25310 102 / 1e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032502 [exp] 285 / 2e-97 AT5G07480 396 / 3e-138 KAR-UP oxidoreductase 1 (.1) Lus10014398 [exp] 135 / 7e-39 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 135 / 8e-39 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022292 [exp] 115 / 2e-31 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1) Lus10011002 [exp] 114 / 4e-31 AT2G44800 198 / 9e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10011979 [exp] 110 / 3e-29 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1) Lus10032574 [exp] 108 / 1e-28 AT4G25300 419 / 2e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10032930 [exp] 106 / 5e-28 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10011980 [exp] 106 / 5e-28 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G080600 [exp] 210 / 3e-68 AT5G07480 453 / 9e-161 KAR-UP oxidoreductase 1 (.1) Potri.008G029700 [exp] 130 / 3e-37 AT2G36690 478 / 1e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G231500 [exp] 129 / 1e-36 AT2G36690 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G048900 [exp] 118 / 2e-32 AT2G36690 250 / 5e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G048700 [exp] 115 / 3e-31 AT2G36690 255 / 3e-82 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G355100 [exp] 112 / 4e-30 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1) Potri.001G451700 [exp] 106 / 3e-28 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G382400 [exp] 104 / 2e-27 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1) Potri.001G381700 [exp] 103 / 8e-27 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1) Potri.012G006300 [exp] 101 / 3e-26 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10042999 pacid=23168134 polypeptide=Lus10042999 locus=Lus10042999.g ID=Lus10042999.BGIv1.0 annot-version=v1.0 ATGGTGGTCAACTGTTATCCGCCGTGTCCAAGCCCAGACCTCACATTGGGCCTGCCACCTCATTCCGACTACAGTTGTCTAACTGTAGTGCTCCAGACCG CTTCAGGTTTGCAGATCCTTGACCAAAGAGACGCCACGTGGAAAGCGACACCTAACGCTCACGGCGCTCTCCTCGTACACGTGGGGGACCACCTAGAGGT GCTGAGCAATGGAATTTACAAAAGCGTGGTTCATCGGGCAACTTTGAACTCGGAGAAGACGAGGATATCGATCGCCAGCTTGCAGAGTCTGGGAATGGAT GATACGATGGAAGTTGCGATTGAGCTTGTTGGTGACGGCGCCGGCGGAGAGGCTAGGTATAAAGGAAGCAGCTTCAGGGATTTTCTTGATCTTCTGTCTA AGAACGACATCGGTACTAAGAACTTCAAGAGCTTTATTGATTCCCTCAAGATCCACAATTAA
AA sequence Show only first row Show all	>Lus10042999 pacid=23168134 polypeptide=Lus10042999 locus=Lus10042999.g ID=Lus10042999.BGIv1.0 annot-version=v1.0 MVVNCYPPCPSPDLTLGLPPHSDYSCLTVVLQTASGLQILDQRDATWKATPNAHGALLVHVGDHLEVLSNGIYKSVVHRATLNSEKTRISIASLQSLGMD DTMEVAIELVGDGAGGEARYKGSSFRDFLDLLSKNDIGTKNFKSFIDSLKIHN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10042999 [exp]	0	1
					Lus10024618 [exp]	3.2	0.9139
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Lus10038182 [exp]	4.4	0.6899
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10000190 [exp]	4.7	0.8831
					Lus10025954 [exp]	6.0	0.8160
					Lus10010697 [exp]	6.2	0.8761
AT4G13230			Late embryogenesis abundant pr...		Lus10022822 [exp]	7.2	0.8761
AT5G20610			unknown protein		Lus10025003 [exp]	8.1	0.8761
					Lus10008327 [exp]	8.8	0.8761
AT2G27110	FAR1_related	FRS3	FAR1-related sequence 3 (.1.2....		Lus10008762 [exp]	9.5	0.8761
AT5G12480		CPK7	calmodulin-domain protein kina...		Lus10026300 [exp]	10.2	0.8556

Compare expression of checked genes

Lus10042999 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.