Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07480 177 / 1e-54 KUOX1 KAR-UP oxidoreductase 1 (.1) AT3G60290 152 / 7e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G44800 151 / 2e-44 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 110 / 1e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 108 / 1e-28 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 100 / 2e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10500 99 / 8e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19010 80 / 4e-18 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G19000 77 / 4e-17 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G08640 77 / 7e-17 ATFLS1, FLS flavonol synthase 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032502 [exp] 314 / 3e-108 AT5G07480 396 / 3e-138 KAR-UP oxidoreductase 1 (.1) Lus10030185 [exp] 139 / 5e-40 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015573 [exp] 114 / 2e-30 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 112 / 9e-30 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10011002 [exp] 108 / 3e-28 AT2G44800 198 / 9e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 102 / 8e-26 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035782 [exp] 100 / 4e-25 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 100 / 6e-25 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014398 [exp] 98 / 3e-24 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G080600 [exp] 216 / 1e-69 AT5G07480 453 / 9e-161 KAR-UP oxidoreductase 1 (.1) Potri.001G451700 [exp] 129 / 3e-36 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 122 / 2e-33 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.014G106700 [exp] 121 / 4e-33 AT4G10490 468 / 2e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 115 / 9e-31 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G231500 [exp] 112 / 1e-29 AT2G36690 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.015G002800 [exp] 110 / 4e-29 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451600 [exp] 110 / 6e-29 AT4G10500 406 / 5e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.012G006300 [exp] 109 / 9e-29 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.008G029700 [exp] 105 / 4e-27 AT2G36690 478 / 1e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043000 pacid=23168322 polypeptide=Lus10043000 locus=Lus10043000.g ID=Lus10043000.BGIv1.0 annot-version=v1.0 ATGGATCATCGCAAGGAATCGGACAGCAGTAACTACTTCCACATGGGGAACACTGCTCAGGAACATGCCCTACCTTATGTGCCCGATTGTTACGTTGTGC CTGATCCATCCGATCGTTCTTCCCCTAATGATCCTACCGCTGACATTCCCGTCATCGACTTGAGTGGGCTACGAGACGCTGCCCAGAGGACTGATGTCGT TGATGAAATTGGAAAGGCTTCTCGCCAACTGGGTTTCTTCCAAGTTGTGAATCACGGGATAAAGCAGTCGGTGTTGGACGAAGCACTGGAAGCCGCCGAC GAGTTCTTCAAGTTGCCAGCAGGGGAGAAGGCCAAGCTCATGTCCAACGACGTTTACAATCCGGTGAGATACGGTACCAGCATCAAAGATGGAATGGACA AAGTCCAGTTCTGGAGGGTATTCCTCAAACACTACGCTAATCCGCTCACCGAGTGGATTCACCTCTGGCCCCAAAACCCGCCAAACTACAGAGAAAAAAT AAGCAATTACTGCACGGAGGTGAGGAAGCTGACGACGGAGATAGCCGGAGCCATGACGGAGTCTTGGTCTGGGCCCATCGTACCTGGACCATAA
AA sequence Show only first row Show all	>Lus10043000 pacid=23168322 polypeptide=Lus10043000 locus=Lus10043000.g ID=Lus10043000.BGIv1.0 annot-version=v1.0 MDHRKESDSSNYFHMGNTAQEHALPYVPDCYVVPDPSDRSSPNDPTADIPVIDLSGLRDAAQRTDVVDEIGKASRQLGFFQVVNHGIKQSVLDEALEAAD EFFKLPAGEKAKLMSNDVYNPVRYGTSIKDGMDKVQFWRVFLKHYANPLTEWIHLWPQNPPNYREKISNYCTEVRKLTTEIAGAMTESWSGPIVPGP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	0	1
AT5G12060			Plant self-incompatibility pro...		Lus10023195 [exp]	2.0	0.9986
AT5G17600			RING/U-box superfamily protein...		Lus10008458 [exp]	2.8	0.9986
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10023047 [exp]	3.5	0.9986
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10028418 [exp]	3.6	0.9648
AT4G35610	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10035994 [exp]	4.0	0.9972
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10030505 [exp]	5.0	0.9963
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	5.5	0.9950
AT1G76810			eukaryotic translation initiat...		Lus10023474 [exp]	5.9	0.9947
AT5G54010			UDP-Glycosyltransferase superf...		Lus10008453 [exp]	6.3	0.9945
AT2G26390			Serine protease inhibitor (SER...		Lus10039336 [exp]	6.3	0.9897

Compare expression of checked genes

Lus10043000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.