Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) AT1G07770 263 / 1e-92 RPS15A ribosomal protein S15A (.1.2) AT3G46040 262 / 3e-92 RPS15AD ribosomal protein S15A D (.1) AT2G39590 247 / 3e-86 Ribosomal protein S8 family protein (.1) AT4G29430 147 / 8e-47 RPS15AE ribosomal protein S15A E (.1) AT2G19720 142 / 8e-45 RPS15AB ribosomal protein S15A B (.1) ATCG00770 40 / 7e-05 ATCG00770.1, RPS8 ribosomal protein S8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023429 [exp] 267 / 7e-94 AT5G59850 264 / 9e-93 Ribosomal protein S8 family protein (.1) Lus10040309 [exp] 266 / 1e-93 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10029461 [exp] 266 / 1e-93 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10032503 [exp] 266 / 1e-93 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10005960 [exp] 266 / 1e-93 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10040543 [exp] 134 / 1e-41 AT4G29430 236 / 4e-82 ribosomal protein S15A E (.1) Lus10000975 [exp] 134 / 2e-41 AT4G29430 235 / 2e-81 ribosomal protein S15A E (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G208700 [exp] 259 / 5e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.001G118100 [exp] 259 / 5e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.003G114800 [exp] 259 / 5e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.008G051900 [exp] 257 / 4e-90 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.009G071250 [exp] 135 / 7e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1) Potri.009G071400 [exp] 135 / 7e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00410 [flax] [poplar] Ribosomal_S8 Ribosomal protein S8
Representative CDS sequence Show only first row Show all	>Lus10043001 pacid=23167947 polypeptide=Lus10043001 locus=Lus10043001.g ID=Lus10043001.BGIv1.0 annot-version=v1.0 ATGGTGAGAATCAGCGTTTTGAACGATGCTCTGAAGAGCATGTATAATGCCGAGAAGCGAGGAAAACGCCAGGTCATGATCAGACCTTCCTCAAAAGTGA TCATCAAGTTTCTTATTGTCATGCAGAAGCATGGATACATTGGCGAATTCGAATACGTTGATGATCACAGGGCCGGTAAGATTGTCGTAGAGTTGAATGG AAGGCTGAACAAATGTGGTGTCATCAGTCCACGATTCGACATCGGTGTCAAAGAGATTGAAGGTTGGACTGCTAGGTTGCTTCCATCTAGACAGTTTGGA TTCATCGTGCTGACAACTTCTGCTGGCATTATGGACCATGAGGAGGCAAGGAGGAAGAATGTGGGCGGGAAAGTGCTTGGTTTCTTCTACTAA
AA sequence Show only first row Show all	>Lus10043001 pacid=23167947 polypeptide=Lus10043001 locus=Lus10043001.g ID=Lus10043001.BGIv1.0 annot-version=v1.0 MVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFG FIVLTTSAGIMDHEEARRKNVGGKVLGFFY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07770		RPS15A	ribosomal protein S15A (.1.2)		Lus10043001 [exp]	0	1
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Lus10022057 [exp]	2.4	0.9628
AT5G57290			60S acidic ribosomal protein f...		Lus10012714 [exp]	5.3	0.9387
AT1G25260			Ribosomal protein L10 family p...		Lus10043280 [exp]	5.5	0.9312
AT1G22780		RPS18A, PFL1, P...	40S RIBOSOMAL PROTEIN S18, POI...		Lus10042603 [exp]	5.5	0.9487
AT4G14320			Zinc-binding ribosomal protein...		Lus10000176 [exp]	5.7	0.9415
AT4G26210			Mitochondrial ATP synthase sub...		Lus10001771 [exp]	6.9	0.9359
AT3G22320		RPB5A, NRPD5, N...	RNA POLYMERASE II FIFTH LARGES...		Lus10001335 [exp]	7.7	0.9251
AT1G08610			Pentatricopeptide repeat (PPR)...		Lus10022025 [exp]	8.2	0.9224
AT5G23535			KOW domain-containing protein ...		Lus10022069 [exp]	8.5	0.9323
AT3G16780			Ribosomal protein L19e family ...		Lus10037707 [exp]	9.5	0.9298

Compare expression of checked genes

Lus10043001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.