Lus10043026 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G35190 407 / 2e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT3G46490 359 / 1e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G46480 296 / 2e-99 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G46500 275 / 1e-91 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G16770 245 / 6e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G16765 205 / 2e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT3G50210 114 / 7e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT3G49630 112 / 4e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G49620 98 / 7e-23 DIN11 DARK INDUCIBLE 11, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G19010 94 / 2e-21 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011126 596 / 0 AT1G35190 415 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10012963 502 / 1e-179 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10034964 501 / 2e-179 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10004746 235 / 5e-75 AT4G16770 370 / 7e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10007820 185 / 6e-56 AT4G16770 291 / 4e-98 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021002 100 / 9e-24 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10023602 79 / 2e-16 AT3G11180 158 / 5e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10004387 80 / 3e-16 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10023851 79 / 5e-16 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G086900 488 / 2e-174 AT1G35190 478 / 6e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.018G086800 478 / 4e-170 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.003G079600 254 / 1e-82 AT4G16770 359 / 1e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.007G047100 110 / 1e-27 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Potri.004G146100 89 / 2e-19 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.004G146000 87 / 8e-19 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.009G107600 81 / 7e-17 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.006G101100 79 / 3e-16 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.016G117100 77 / 1e-15 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G150300 76 / 4e-15 AT4G10500 327 / 4e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10043026 pacid=23168010 polypeptide=Lus10043026 locus=Lus10043026.g ID=Lus10043026.BGIv1.0 annot-version=v1.0
ATGGCGAATCAGCAGCAGCAACAGCAAGGAAATCGCACCGCCGTAACTTCACTGAATTGCATTGATCTCTCCACCCCGGTCGACTCTCCTAATTCCGTCT
CCTTGCTCAAACAGCAGGCGTGCCTGGATTGTGGGTTTTTCTACTTGGTCAATCATGGGATAAGCCAAGAGTTCATGGTGGAAGTTTTTGCTCAGAGCAA
GAAGTTCTTCGAATTGCCACTGGTTGAGAAGATGAAAGTTCTTAGGAACGAGAAGCATAGAGGGTACACTCCAGAGCTGGACGAGCTTTTGGATCCTGGA
AATCAACTTCATGGAGATTATAAGGAGGGTTACTATATAGGATTAGAAATTCCTGAAGATGACCCTGCAGCCAAAAATCCATTCCATGGTCCTAACGTTT
GGCCATCATCAGACCTTTTGCCTGGTTGGAGGGAAACCATGGAAAAGTTTCATCAGCAAGCTCTAGAGGTAGCGCGAAAAGTTGCGAGGATTATAGCTCT
TGCGCTTGATTTAGAAGCTGATTTCTTCGACAAACCGGAGATTCTTGGTGACCAGCCCATTGCACTAATGCGATTGCTGCGCTATGGAGGTCAAGTTTCT
GATCCCATGAAGGGATTATATGGAGCTGGGGCCCATTCTGACTATGGTTTGATTACCCTCCTTGCCACAGATGAAGTCTATGGTCTCCAAATATGTAGGA
ATAAGAGTGGTGAACCTCAAGTATGGGAATATGTACCACCAATGCAAGGGTTGAAGATACTGATGTATGTTCTCTTTCGTGTCGAACAGAGCTTTCGTGG
TAAATCTGGGGGACATGTTAGAGCGGTGGAGCAACTGTGTGTTCAAGTAAATATTCATGCTACTAGCTTTGCAGCATTTCCCAAGTCGACATTACATAGA
GTTATAGGGAATGGTCAAGAGAGATATTCCATTGCATACTTCGTGGAGCCGAATTATGATTGTCTAGTCGAATGCTTGTCAACATGTAAATGGGAGAAAT
ATCCACCCAAGTTCCCCCCAGTCAAATATGGAGAATACTTGGGGCAACGCTACAAGGACACCCATGCTGATTTGAGGGTTTACAGCCAGAAGCAGCCATA
G
AA sequence
>Lus10043026 pacid=23168010 polypeptide=Lus10043026 locus=Lus10043026.g ID=Lus10043026.BGIv1.0 annot-version=v1.0
MANQQQQQQGNRTAVTSLNCIDLSTPVDSPNSVSLLKQQACLDCGFFYLVNHGISQEFMVEVFAQSKKFFELPLVEKMKVLRNEKHRGYTPELDELLDPG
NQLHGDYKEGYYIGLEIPEDDPAAKNPFHGPNVWPSSDLLPGWRETMEKFHQQALEVARKVARIIALALDLEADFFDKPEILGDQPIALMRLLRYGGQVS
DPMKGLYGAGAHSDYGLITLLATDEVYGLQICRNKSGEPQVWEYVPPMQGLKILMYVLFRVEQSFRGKSGGHVRAVEQLCVQVNIHATSFAAFPKSTLHR
VIGNGQERYSIAYFVEPNYDCLVECLSTCKWEKYPPKFPPVKYGEYLGQRYKDTHADLRVYSQKQP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G35190 2-oxoglutarate (2OG) and Fe(II... Lus10043026 0 1
AT1G10070 ATBCAT-2 branched-chain amino acid tran... Lus10028247 1.7 0.9831
AT5G47720 Thiolase family protein (.1.2.... Lus10039109 3.0 0.9790
AT1G10070 ATBCAT-2 branched-chain amino acid tran... Lus10007247 3.7 0.9792
AT1G70460 AtPERK13, RHS10 proline-rich extensin-like rec... Lus10030879 4.2 0.9758
AT1G11530 ATCXXS1 C-terminal cysteine residue is... Lus10018383 4.5 0.9737
AT2G18250 ATCOAD 4-phosphopantetheine adenylylt... Lus10028311 5.1 0.9704
AT2G43400 ETFQO electron-transfer flavoprotein... Lus10027045 5.7 0.9747
AT5G53160 RCAR3, PYL8 PYR1-like 8, regulatory compon... Lus10039335 6.7 0.9694
AT1G11380 PLAC8 family protein (.1) Lus10018410 7.4 0.9765
AT1G13450 Trihelix GT-1 GT-1, Homeodomain-like superfa... Lus10036978 7.5 0.9781

Lus10043026 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.