Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10020 37 / 0.0005 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011136 [exp] 134 / 1e-42 ND 36 / 0.001
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G106700 [exp] 60 / 1e-13 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043038 pacid=23168112 polypeptide=Lus10043038 locus=Lus10043038.g ID=Lus10043038.BGIv1.0 annot-version=v1.0 ATGAGGAACACCGGAAAGAGTTACAAAGCTGCTCAGAATGGCAACAACAGCAGCAGCAACAACAAGACCTTCGATGCTAGGCTGGACAGGAAATCAGCAA CTGGTATGAACGGATCTCCCAAGAAAGGAGGCCACGGAGGCAAGTTCACTTGGATCGGTGGCGACGGTTTCTACTCACACGAAGAGATGGGGCGCCACGG CGGCGGAGTAGCAGCTGCGGATCTCATCTCGCAGGAGGAGGAGGTCCCGATCCAGACCCCCTGA
AA sequence Show only first row Show all	>Lus10043038 pacid=23168112 polypeptide=Lus10043038 locus=Lus10043038.g ID=Lus10043038.BGIv1.0 annot-version=v1.0 MRNTGKSYKAAQNGNNSSSNNKTFDARLDRKSATGMNGSPKKGGHGGKFTWIGGDGFYSHEEMGRHGGGVAAADLISQEEEVPIQTP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10043038 [exp]	0	1
AT4G31040			CemA-like proton extrusion pro...		Lus10040575 [exp]	1.4	0.8955
AT2G37678		PAT3, FRY1, FHY...	PHYTOCHROME A SIGNAL TRANSDUCT...		Lus10012123 [exp]	3.7	0.8857
					Lus10015768 [exp]	6.5	0.8213
AT1G08570		ACHT4	atypical CYS HIS rich thiored...		Lus10003437 [exp]	6.6	0.8347
					Lus10007178 [exp]	9.3	0.7943
AT3G19860	bHLH	bHLH121	basic Helix-Loop-Helix 121, ba...		Lus10028456 [exp]	10.5	0.8354
AT5G24490			30S ribosomal protein, putativ...		Lus10015569 [exp]	10.7	0.8485
AT5G24490			30S ribosomal protein, putativ...		Lus10032935 [exp]	11.1	0.8552
AT2G41430		LSR1, CID1, ERD...	CTC-Interacting Domain 1, dehy...		Lus10009847 [exp]	11.2	0.8471
AT2G17020			F-box/RNI-like superfamily pro...		Lus10012518 [exp]	11.2	0.8360

Compare expression of checked genes

Lus10043038 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.