Lus10043040 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G19760 223 / 1e-76 PRF1, PFN1 profilin 1 (.1)
AT5G56600 223 / 3e-76 PRF3, PFN3 profilin 3 (.1.2)
AT4G29350 220 / 2e-75 PRF2, PFN2, PRO2 profilin 2 (.1)
AT2G19770 215 / 1e-73 PRF5 profilin 5 (.1)
AT4G29340 212 / 3e-72 PRF4 profilin 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011138 265 / 5e-93 AT2G19760 225 / 2e-77 profilin 1 (.1)
Lus10012936 253 / 2e-88 AT4G29350 223 / 2e-76 profilin 2 (.1)
Lus10034988 251 / 2e-87 AT4G29340 219 / 3e-75 profilin 4 (.1)
Lus10037591 234 / 5e-81 AT2G19770 231 / 6e-80 profilin 5 (.1)
Lus10006846 232 / 4e-80 AT2G19770 229 / 5e-79 profilin 5 (.1)
Lus10034989 214 / 6e-73 AT4G29340 234 / 6e-81 profilin 4 (.1)
Lus10011139 212 / 2e-72 AT4G29340 238 / 1e-82 profilin 4 (.1)
Lus10043041 212 / 4e-72 AT4G29340 239 / 9e-83 profilin 4 (.1)
Lus10012935 207 / 2e-70 AT4G29340 235 / 2e-81 profilin 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G190800 241 / 6e-84 AT2G19760 196 / 8e-66 profilin 1 (.1)
Potri.003G047700 238 / 2e-82 AT4G29340 224 / 5e-77 profilin 4 (.1)
Potri.018G057600 231 / 1e-79 AT4G29340 188 / 5e-63 profilin 4 (.1)
Potri.006G235200 228 / 1e-78 AT4G29340 216 / 1e-73 profilin 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF00235 Profilin Profilin
Representative CDS sequence
>Lus10043040 pacid=23167960 polypeptide=Lus10043040 locus=Lus10043040.g ID=Lus10043040.BGIv1.0 annot-version=v1.0
ATGTCGTGGCAGACCTACGTTGACGACCATCTCCTCTGCGACGTCGAGGGTAACCACCTCTCTGCCGCCGCCATCATCGGCCACGACGGCAGCGTTTGGG
CCCAGAGCGCCACCTTCCCTCAGTTGAAACCTGAAGAAGTTACTGGTGTTATGAATGACTTCGAAGAACCTGGTTCACTAGCACCCACTGGATTGTACCT
TGGAGGCACAAAGTACATGGTGATTCAAGGCGAGGCAGGAGCTGTCATCCGAGGGAAGAAGGGTGCTGGCGGAGTAACCATTAAGAAGACCAGTCTTGCC
TTGGTGATTGGTATCTACGATGAGCCAATGACCCCAGGACAGTGCAATGTAGTCGTTGAAAGGCTTGGCGATTATCTTGTCGATCAGGGTCTTTAA
AA sequence
>Lus10043040 pacid=23167960 polypeptide=Lus10043040 locus=Lus10043040.g ID=Lus10043040.BGIv1.0 annot-version=v1.0
MSWQTYVDDHLLCDVEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGVMNDFEEPGSLAPTGLYLGGTKYMVIQGEAGAVIRGKKGAGGVTIKKTSLA
LVIGIYDEPMTPGQCNVVVERLGDYLVDQGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G56600 PRF3, PFN3 profilin 3 (.1.2) Lus10043040 0 1
AT3G05500 Rubber elongation factor prote... Lus10029892 1.4 0.8565
AT3G52710 unknown protein Lus10022708 2.0 0.8438
AT4G38690 PLC-like phosphodiesterases su... Lus10025062 4.5 0.8259
AT5G40250 RING/U-box superfamily protein... Lus10032161 5.5 0.8313
AT2G25290 Phox1 Phox1, Octicosapeptide/Phox/Be... Lus10001947 6.9 0.7942
AT1G11360 Adenine nucleotide alpha hydro... Lus10039730 8.1 0.7955
AT1G23750 Nucleic acid-binding, OB-fold-... Lus10030871 8.4 0.8107
AT5G25450 Cytochrome bd ubiquinol oxidas... Lus10008081 8.4 0.8218
AT3G22845 emp24/gp25L/p24 family/GOLD fa... Lus10041182 10.2 0.7914
Lus10026314 11.7 0.8193

Lus10043040 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.