Lus10043041 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29340 207 / 2e-70 PRF4 profilin 4 (.1)
AT2G19770 198 / 9e-67 PRF5 profilin 5 (.1)
AT4G29350 176 / 4e-58 PRF2, PFN2, PRO2 profilin 2 (.1)
AT2G19760 170 / 1e-55 PRF1, PFN1 profilin 1 (.1)
AT5G56600 161 / 8e-52 PRF3, PFN3 profilin 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011139 237 / 3e-82 AT4G29340 238 / 1e-82 profilin 4 (.1)
Lus10034989 231 / 7e-80 AT4G29340 234 / 6e-81 profilin 4 (.1)
Lus10012935 227 / 4e-78 AT4G29340 235 / 2e-81 profilin 4 (.1)
Lus10037591 200 / 2e-67 AT2G19770 231 / 6e-80 profilin 5 (.1)
Lus10006846 198 / 1e-66 AT2G19770 229 / 5e-79 profilin 5 (.1)
Lus10012936 193 / 8e-65 AT4G29350 223 / 2e-76 profilin 2 (.1)
Lus10034988 192 / 3e-64 AT4G29340 219 / 3e-75 profilin 4 (.1)
Lus10011138 186 / 1e-61 AT2G19760 225 / 2e-77 profilin 1 (.1)
Lus10043040 184 / 5e-61 AT5G56600 223 / 1e-76 profilin 3 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G190800 197 / 2e-66 AT2G19760 196 / 8e-66 profilin 1 (.1)
Potri.003G047700 194 / 2e-65 AT4G29340 224 / 5e-77 profilin 4 (.1)
Potri.006G235200 189 / 4e-63 AT4G29340 216 / 1e-73 profilin 4 (.1)
Potri.018G057600 186 / 7e-62 AT4G29340 188 / 5e-63 profilin 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF00235 Profilin Profilin
Representative CDS sequence
>Lus10043041 pacid=23168120 polypeptide=Lus10043041 locus=Lus10043041.g ID=Lus10043041.BGIv1.0 annot-version=v1.0
ATGTCGTGGCAGACGTACGTAGACGAGCACTTGATGTGCGAGATCGAAGGGCAGCAGGGACAACACCTGGCATCTGCCGCCATCGTCGGCCATGACGGTA
GCATCTGGGCCCAGAGCTCCGCCTTCCCTCAGTTCAAAGGAACAGAGGTGAGTGACATAATGAAAGATTTCGATGAGCCAGGGCACCTTGCCCCTACCGG
ATTGCACATTGCTGGTGCCAAGTATATGGTTATTCAGGGCGAGTCTGGTGCTGTCATCCGTGGCAAGAAGGGAGCTGGAGGTATAACCATAAAAAAGACA
GGGCAAGCACTAGTGGTGGGGATGTACGAGGAGCCAGTGACTCCAGGGCAATGCAACATGATTGTGGAGAGGTTGGGTGATTACCTCCTGGAGCAGGGTC
TCTAG
AA sequence
>Lus10043041 pacid=23168120 polypeptide=Lus10043041 locus=Lus10043041.g ID=Lus10043041.BGIv1.0 annot-version=v1.0
MSWQTYVDEHLMCEIEGQQGQHLASAAIVGHDGSIWAQSSAFPQFKGTEVSDIMKDFDEPGHLAPTGLHIAGAKYMVIQGESGAVIRGKKGAGGITIKKT
GQALVVGMYEEPVTPGQCNMIVERLGDYLLEQGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29340 PRF4 profilin 4 (.1) Lus10043041 0 1
AT4G01830 ABCB5, PGP5 ATP-binding cassette B5, P-gly... Lus10004529 6.2 1.0000
Lus10011759 8.7 1.0000
AT2G20420 ATP citrate lyase (ACL) family... Lus10024923 10.7 1.0000
AT4G00750 S-adenosyl-L-methionine-depend... Lus10027433 12.3 1.0000
Lus10013545 13.8 1.0000
AT4G24975 Plant self-incompatibility pro... Lus10032383 15.1 1.0000
AT3G50440 ATMES10 ARABIDOPSIS THALIANA METHYL ES... Lus10038486 15.5 1.0000
Lus10017303 16.3 1.0000
AT2G20370 AtMUR3, MUR3, K... MURUS 3, KATAMARI 1, Exostosin... Lus10040003 20.3 1.0000
Lus10000550 22.2 1.0000

Lus10043041 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.