Lus10043047 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G50720 124 / 6e-37 Stigma-specific Stig1 family protein (.1)
AT4G26880 117 / 7e-34 Stigma-specific Stig1 family protein (.1)
AT5G55110 112 / 6e-32 Stigma-specific Stig1 family protein (.1)
AT1G11925 75 / 1e-17 Stigma-specific Stig1 family protein (.1)
AT1G53130 64 / 4e-13 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1)
AT1G50650 58 / 7e-11 Stigma-specific Stig1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011146 225 / 3e-76 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Lus10011117 216 / 2e-72 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1)
Lus10041930 75 / 3e-17 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10005544 73 / 4e-17 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10020831 61 / 7e-12 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1)
Lus10012679 61 / 8e-12 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
Lus10006512 58 / 4e-11 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1)
Lus10000696 59 / 1e-10 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G356600 140 / 7e-43 AT1G50720 133 / 2e-40 Stigma-specific Stig1 family protein (.1)
Potri.011G080800 130 / 5e-39 AT1G50720 130 / 3e-39 Stigma-specific Stig1 family protein (.1)
Potri.004G030900 91 / 1e-23 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1)
Potri.004G006800 86 / 5e-22 AT1G11925 80 / 1e-19 Stigma-specific Stig1 family protein (.1)
Potri.011G008932 82 / 5e-20 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1)
Potri.004G006900 81 / 5e-20 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
Potri.010G228100 72 / 1e-16 AT1G11925 94 / 2e-25 Stigma-specific Stig1 family protein (.1)
Potri.004G007200 72 / 5e-16 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007000 71 / 5e-16 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007100 70 / 1e-15 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04885 Stig1 Stigma-specific protein, Stig1
Representative CDS sequence
>Lus10043047 pacid=23168430 polypeptide=Lus10043047 locus=Lus10043047.g ID=Lus10043047.BGIv1.0 annot-version=v1.0
ATGACCACCACCACGGTTCTCGTCAAGACAATGCTGCTCATATTCGTGGCCACCGCCATCTCCGTCACCCTCACCATGCAAACCATCAACCCTCCTCAAC
AAGAAACCACTAGGCCCGTTAGCCGATTCCTCAAGCAAGAAGACACTTCTAGTACTACTCCTACAGGCGATGGCATCCCCGGGATCGGTGGAAACAACGG
AAACGGTGAAGGAGGGGGAGGGATCAAGAACCCCAAGGCCGCCGACCACTGCAACAAAGACCCCGGTTTGTGCGAGGCTCTGTACGGTAAGGGCTTTGCC
TGTTGCAACAACAAGTGTAAGGACTTGAAATTCGACAAGCAGAACTGCGGGGCGTGCAAGACCAAGTGCGACTTCATGGACGAATGCTGCCGCGGGGAGT
GCGTCTTCCTGGCCATCGACAAGCGCCACTGCGGAAAGTGCAATTCCCCTTGTCCCCCTGGCCAGCCCTGCGTCTATGGCATGTGCAACTACGCTTGA
AA sequence
>Lus10043047 pacid=23168430 polypeptide=Lus10043047 locus=Lus10043047.g ID=Lus10043047.BGIv1.0 annot-version=v1.0
MTTTTVLVKTMLLIFVATAISVTLTMQTINPPQQETTRPVSRFLKQEDTSSTTPTGDGIPGIGGNNGNGEGGGGIKNPKAADHCNKDPGLCEALYGKGFA
CCNNKCKDLKFDKQNCGACKTKCDFMDECCRGECVFLAIDKRHCGKCNSPCPPGQPCVYGMCNYA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G50720 Stigma-specific Stig1 family p... Lus10043047 0 1
AT5G54370 Late embryogenesis abundant (L... Lus10026972 1.4 0.9913
AT5G60520 Late embryogenesis abundant (L... Lus10031532 2.4 0.9901
AT3G20820 Leucine-rich repeat (LRR) fami... Lus10002551 3.9 0.9852
AT5G54370 Late embryogenesis abundant (L... Lus10037886 4.0 0.9814
AT5G60520 Late embryogenesis abundant (L... Lus10015149 5.3 0.9728
AT5G60520 Late embryogenesis abundant (L... Lus10015148 5.7 0.9682
AT1G50720 Stigma-specific Stig1 family p... Lus10011146 6.7 0.9705
AT4G10350 NAC BRN2, NST4, ANA... BEARSKIN 2, NAC domain contain... Lus10013782 7.1 0.9623
AT1G50720 Stigma-specific Stig1 family p... Lus10011117 8.4 0.9407
AT3G14470 NB-ARC domain-containing disea... Lus10002609 8.5 0.9744

Lus10043047 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.