Lus10043049 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12410 111 / 3e-30 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G36110 108 / 7e-29 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12430 103 / 5e-27 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12470 102 / 6e-27 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12460 101 / 3e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12440 100 / 3e-25 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12420 73 / 7e-16 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT4G13870 57 / 1e-09 WRNEXO, ATWRNEXO, WEX, ATWEX Werner syndrome-like exonuclease (.1.2)
AT5G06450 42 / 0.0001 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039164 111 / 3e-30 AT4G13870 105 / 2e-27 Werner syndrome-like exonuclease (.1.2)
Lus10013769 110 / 9e-30 AT4G13870 105 / 4e-27 Werner syndrome-like exonuclease (.1.2)
Lus10029479 95 / 4e-24 AT2G36110 87 / 4e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029478 82 / 2e-19 AT5G48350 82 / 2e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10039591 72 / 1e-15 AT3G12410 86 / 1e-20 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10010357 48 / 2e-06 AT3G11770 66 / 7e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036491 48 / 2e-06 AT3G11770 64 / 4e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G028700 103 / 3e-27 AT4G13870 104 / 5e-27 Werner syndrome-like exonuclease (.1.2)
Potri.006G031400 101 / 2e-26 AT3G12410 101 / 2e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.011G116000 97 / 4e-25 AT3G12410 91 / 2e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.017G059200 67 / 5e-13 AT4G13870 288 / 4e-97 Werner syndrome-like exonuclease (.1.2)
Potri.019G021900 55 / 4e-09 AT3G11770 77 / 3e-17 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.002G185500 50 / 3e-07 AT3G12410 45 / 1e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G028501 47 / 2e-06 ND /
Potri.016G028400 46 / 4e-06 ND /
Potri.006G031300 44 / 2e-05 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Representative CDS sequence
>Lus10043049 pacid=23168113 polypeptide=Lus10043049 locus=Lus10043049.g ID=Lus10043049.BGIv1.0 annot-version=v1.0
ATGAATTCTGCCATGGCGATCGAGTCTCCCGATGATTACGACCTGCACCGTGAGCGCACATTCACCCTCCGTTTATTCGACAACCGCAGGATTCGGACCA
CCGTCACTTCTACTCCTTCCGTGGTACGCAAATGGATCTGGTACTCGCTCGAAAAACACCGCTACCTTCGCCACAAGCTTGTGGTTGGGCTCGGCGTCCA
ATGGCGCGCTCCCTACGACACATCCGCCGCAACTCTCCAGCTATGCATCGGCTCCCGCTGCCTGATCTACCAACTCCGACACGCCGGCTACATCCCTCGC
AGTCTCGAGCGGTTCCTTGCCGACACTGACATCACTTTCGTCGGCGTTCAGAACCACAGGGATGCAGATATGCTGCGGGAGCATGACCTCCAAGTGGGTA
CGCTTCTTGATCTCTGTGACATCTCTGCTCAATCCAGAGGATTTGGTAGGAATTCTTCGATGGAGGATCTGGCGCTGAGGATTTTGGGTTATGAGGGAGT
TCGTAAGTCTGTGTATGTTGGTATGAGTAATTGGAATGCTGATTGGCTCTCTGATGAGCAAGTGCTGTATGCTTGTGTTGATGCTGTTGTCAGTTTCATG
CTCGGAGTTGAATTGGAAGCCTGGAGGTGGAACTGA
AA sequence
>Lus10043049 pacid=23168113 polypeptide=Lus10043049 locus=Lus10043049.g ID=Lus10043049.BGIv1.0 annot-version=v1.0
MNSAMAIESPDDYDLHRERTFTLRLFDNRRIRTTVTSTPSVVRKWIWYSLEKHRYLRHKLVVGLGVQWRAPYDTSAATLQLCIGSRCLIYQLRHAGYIPR
SLERFLADTDITFVGVQNHRDADMLREHDLQVGTLLDLCDISAQSRGFGRNSSMEDLALRILGYEGVRKSVYVGMSNWNADWLSDEQVLYACVDAVVSFM
LGVELEAWRWN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36110 Polynucleotidyl transferase, r... Lus10043049 0 1
AT5G02540 NAD(P)-binding Rossmann-fold s... Lus10025321 1.0 0.9771
Lus10015131 2.0 0.9621
AT4G36930 bHLH SPT, bHLH024 SPATULA, basic helix-loop-heli... Lus10041592 3.0 0.8655
AT4G08910 unknown protein Lus10025524 3.6 0.8521
AT1G78960 ATLUP2 lupeol synthase 2 (.1) Lus10033355 4.2 0.9130
AT3G61610 Galactose mutarotase-like supe... Lus10010131 4.2 0.8315
Lus10004133 4.6 0.8739
Lus10035120 5.3 0.8988
AT4G23060 IQD22 IQ-domain 22 (.1) Lus10024498 5.4 0.8096
AT5G55590 QRT1 QUARTET 1, Pectin lyase-like s... Lus10016605 6.9 0.8831

Lus10043049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.