Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043052 pacid=23167959 polypeptide=Lus10043052 locus=Lus10043052.g ID=Lus10043052.BGIv1.0 annot-version=v1.0 ATGGTTGCAATTTCTGACCCGGAGAACGCCATTGTTGAGAGCAGAGAAGCTCTAATGGTTTCTCACGTTGGCAACTCCACTCCCACCCTCAGAATGGCTC ATTTCCTTAAACCCACCACAAATGTCTCCTCCTCCTCCTCCACCATTAAAGCAGAGCTGGTCAAGCATCATCCATTACTCTTCCCTTCCTCTTCACCACT GTCCTGCAACGGTAAGATCAAAAAGTGGCCTCTCGAAGTGAGCTTCATGAGCTGGCCGCATAACCCTCCAAACCCTAACTGGAAATCATGA
AA sequence Show only first row Show all	>Lus10043052 pacid=23167959 polypeptide=Lus10043052 locus=Lus10043052.g ID=Lus10043052.BGIv1.0 annot-version=v1.0 MVAISDPENAIVESREALMVSHVGNSTPTLRMAHFLKPTTNVSSSSSTIKAELVKHHPLLFPSSSPLSCNGKIKKWPLEVSFMSWPHNPPNPNWKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10043052 [exp]	0	1
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10029316 [exp]	6.6	0.8806
AT4G02780		ATCPS1, ABC33, ...	GA REQUIRING 1, CPP synthase, ...		Lus10006917 [exp]	9.8	0.8801
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10009400 [exp]	12.4	0.8796
AT1G25270			nodulin MtN21 /EamA-like trans...		Lus10015066 [exp]	14.8	0.8786
AT5G42905			Polynucleotidyl transferase, r...		Lus10036265 [exp]	16.6	0.8711
AT3G05610			Plant invertase/pectin methyle...		Lus10015211 [exp]	16.9	0.8771
AT1G63990		SPO11-2	sporulation 11-2 (.1)		Lus10032302 [exp]	19.3	0.8693
					Lus10007508 [exp]	21.9	0.8673
					Lus10004306 [exp]	23.1	0.6358
AT1G04670			unknown protein		Lus10004041 [exp]	23.2	0.8673

Compare expression of checked genes

Lus10043052 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.