Lus10043055 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G50900 226 / 8e-77 LTD, GDC1 LHCP translocation defect, Grana Deficient Chloroplast 1, Ankyrin repeat family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011151 300 / 4e-106 AT1G50900 225 / 1e-76 LHCP translocation defect, Grana Deficient Chloroplast 1, Ankyrin repeat family protein (.1)
Lus10002765 38 / 0.0007 AT4G18950 132 / 1e-37 Integrin-linked protein kinase family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G420900 244 / 1e-83 AT1G50900 234 / 1e-79 LHCP translocation defect, Grana Deficient Chloroplast 1, Ankyrin repeat family protein (.1)
PFAM info
Representative CDS sequence
>Lus10043055 pacid=23167948 polypeptide=Lus10043055 locus=Lus10043055.g ID=Lus10043055.BGIv1.0 annot-version=v1.0
ATGGCTTCAATACCATGTACAACAACATCGCAGCTCCATGGCTCTTGGAATCAGCAGCCAAAGATGACTTCTTTGTTTCTGGGTAAGCGTAACCAGGTCG
CCTGGGTCCGACCGCGCAGAATCAGAGCATCATCCAAAGTGACGAGAGTGAATGCGTGGTTTAAGTTCGGCAAGAATGGAGTTGATGCTGAAGGTGCTGG
CATTTATGGCAGCCAGTCCCGTGATGACTTTGACAGAGATGATGTCGAACAGTATTTCAACTACATGGGAATGCTTGCCGTGGAAGGGACATATGACAAG
ATGGAAGCACTGCTAACCCAAAACATCCATCCAGTGGACATCTTGCTGATGCTAGCTGCTTCCGAAGGCGATAAGCCCAAACTCGAAGAGCTACTACGAG
CCGGTGCTAATTATGATGTCAAAGATGTCGACGGCAGGACAGCGCTCGATAGAGCTACTGATCAGGAGGTCAAGGACTTCATTCTTAGCTTCTCTACCCA
GAAGGCCTGA
AA sequence
>Lus10043055 pacid=23167948 polypeptide=Lus10043055 locus=Lus10043055.g ID=Lus10043055.BGIv1.0 annot-version=v1.0
MASIPCTTTSQLHGSWNQQPKMTSLFLGKRNQVAWVRPRRIRASSKVTRVNAWFKFGKNGVDAEGAGIYGSQSRDDFDRDDVEQYFNYMGMLAVEGTYDK
MEALLTQNIHPVDILLMLAASEGDKPKLEELLRAGANYDVKDVDGRTALDRATDQEVKDFILSFSTQKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G50900 LTD, GDC1 LHCP translocation defect, Gra... Lus10043055 0 1
AT3G63190 HFP108, AtcpRRF... "ribosome recycling factor, ch... Lus10042587 2.0 0.9825
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Lus10034302 2.0 0.9828
AT4G38160 PDE191 pigment defective 191, Mitocho... Lus10013854 2.6 0.9753
AT1G05190 EMB2394 embryo defective 2394, Ribosom... Lus10029120 3.5 0.9824
AT5G11450 PPD5 PsbP domain protein 5, Mog1/Ps... Lus10022110 4.0 0.9804
AT5G14910 Heavy metal transport/detoxifi... Lus10032167 5.2 0.9693
AT1G17650 GR2, GLYR2 glyoxylate reductase 2 (.1) Lus10037629 5.7 0.9731
AT5G54600 Translation protein SH3-like f... Lus10005180 6.3 0.9774
AT1G78630 EMB1473 embryo defective 1473, Ribosom... Lus10041940 6.5 0.9755
AT2G38140 PSRP4 plastid-specific ribosomal pro... Lus10002497 8.5 0.9682

Lus10043055 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.