Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20600 154 / 5e-47 NDR1 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G20590 131 / 2e-37 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G20610 104 / 1e-27 non-race specific disease resistance protein, putative (.1) AT1G61760 68 / 1e-13 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G05220 66 / 4e-13 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35980 60 / 1e-10 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11650 58 / 4e-10 NHL2 NDR1/HIN1-like 2 (.1) AT5G06320 54 / 8e-09 NHL3 NDR1/HIN1-like 3 (.1) AT2G35460 53 / 3e-08 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G52470 50 / 2e-07 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011162 [exp] 316 / 2e-110 AT3G20600 139 / 3e-41 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021288 [exp] 58 / 3e-10 AT2G35980 237 / 2e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10018376 [exp] 52 / 3e-08 AT4G05220 152 / 3e-46 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016962 [exp] 52 / 6e-08 AT2G35980 237 / 3e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006754 [exp] 51 / 1e-07 AT4G05220 263 / 3e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021287 [exp] 50 / 3e-07 AT2G35980 236 / 7e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020066 [exp] 48 / 1e-06 AT4G05220 261 / 6e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10018377 [exp] 48 / 2e-06 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10032932 [exp] 46 / 8e-06 AT5G53730 211 / 4e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G418000 [exp] 171 / 1e-53 AT3G20600 144 / 7e-43 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.011G133900 [exp] 152 / 3e-46 AT3G20600 152 / 2e-46 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.011G027400 [exp] 68 / 1e-13 AT4G05220 264 / 8e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023300 [exp] 61 / 3e-11 AT4G05220 276 / 7e-95 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023400 [exp] 58 / 3e-10 AT3G20600 59 / 7e-11 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071600 [exp] 55 / 4e-09 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204300 [exp] 52 / 4e-08 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G003800 [exp] 49 / 7e-07 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071500 [exp] 44 / 3e-05 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1) Potri.009G019600 [exp] 44 / 3e-05 AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [flax] [poplar] E-set PF03168 [flax] [poplar] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10043067 pacid=23168389 polypeptide=Lus10043067 locus=Lus10043067.g ID=Lus10043067.BGIv1.0 annot-version=v1.0 ATGTCGTATGGTGGCGGCGAGGGCGCGGGTTTCATCTGCTGCAGGTGGTGCTCCAGCTTCATACTCACCAGTGGCTTCACCGCCCTCTTCTTGTGGCTCA GCCTCCGCCCCTCTTCCCCCAAATGCTACCTCCGCACTTTCTCAATCCCGCCCCTAAACCGCTCCTCCTTGCAGCCTCCGTCGAACGCCAACAACATCTC CTTCGACCTCCGCCTGGTGAACCCCAACGTCAACAAGGGCGTCTACTACGACCCGGTCGAGGTCAGCTTCTTCGGCGACTCCAATCGGAGCAAATCCTTG GGCAATTACACGATCCCGGGGTTCTACCAGGGCCACCAGAAGAAGGCCACAAAAGGTGGGGTGGTACTCATCGTCAACAACGCCACCGGGGAGATTTTAC GGCAGGTGGCTAAGGACAACAATACGACGGCGGCGGCGGCTTTTGAATTCCGTGTCGAAATCGCTACCAGGGTGAGGTATAGGCTGATTTTCTTCAAGAC AAAGAGGCATCGGATTGCTGTTGGCGCCGATTTCCAAGTCAACGGGGAGGGGAAAAAGGTCGCCCCAAAGGATGTGAGGCTCAAGTCCGGCGCCGACAGG GTTGGTGGTGGACACACGTCGCGTAATCGTTGGGCCATGAGTGTTTTACTTTCCTTGTTCTTTCTTGTTTAG
AA sequence Show only first row Show all	>Lus10043067 pacid=23168389 polypeptide=Lus10043067 locus=Lus10043067.g ID=Lus10043067.BGIv1.0 annot-version=v1.0 MSYGGGEGAGFICCRWCSSFILTSGFTALFLWLSLRPSSPKCYLRTFSIPPLNRSSLQPPSNANNISFDLRLVNPNVNKGVYYDPVEVSFFGDSNRSKSL GNYTIPGFYQGHQKKATKGGVVLIVNNATGEILRQVAKDNNTTAAAAFEFRVEIATRVRYRLIFFKTKRHRIAVGADFQVNGEGKKVAPKDVRLKSGADR VGGGHTSRNRWAMSVLLSLFFLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G20600		NDR1	non race-specific disease resi...		Lus10043067 [exp]	0	1
AT2G26530		AR781	Protein of unknown function (D...		Lus10032881 [exp]	1.4	0.9443
AT3G53810			Concanavalin A-like lectin pro...		Lus10016506 [exp]	2.8	0.9182
					Lus10018552 [exp]	3.0	0.9203
AT4G27280			Calcium-binding EF-hand family...		Lus10033753 [exp]	4.2	0.9210
AT4G08950		EXO	EXORDIUM, Phosphate-responsive...		Lus10017050 [exp]	4.5	0.9132
					Lus10039781 [exp]	8.4	0.8979
AT5G60750			CAAX amino terminal protease f...		Lus10024708 [exp]	8.8	0.9116
AT3G49930	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10018696 [exp]	9.5	0.9037
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10007348 [exp]	10.8	0.8980
AT5G37710			alpha/beta-Hydrolases superfam...		Lus10000444 [exp]	11.0	0.8610

Compare expression of checked genes

Lus10043067 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.