Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12760 0 / 1 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001181 [exp] 0 / 1 AT4G12760 221 / 9e-72 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G197700 [exp] 0 / 1 AT4G12760 263 / 2e-88 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043073 pacid=23168137 polypeptide=Lus10043073 locus=Lus10043073.g ID=Lus10043073.BGIv1.0 annot-version=v1.0 ATGGAGGAGAACAACCCTAACTTCGCGCCGGCGACCTCCGGAAGGCAATCGGTTAAGGCGAAATCGCTGGAAAAACAGGATCAGGAGTCTATCAAATCAG CTCTGCAGGGTATTGTTTCTGATGAACTGAAAAGAATCAGACAACCATCATCAGTGGATGATGATGATGATGATGACAACAATAAGAAACTACTGAATGC CCCCAATCTGCTATCGACGATGATGATATGCTATGGGAGTACGACGGCCTGCATGATGCTTATGACGGTGATTGCGAAGAGATATTGTTGGAGATGCAAC GGATCTTCTATGAGGATCTCAAGGAAGAATCAAATATGA
AA sequence Show only first row Show all	>Lus10043073 pacid=23168137 polypeptide=Lus10043073 locus=Lus10043073.g ID=Lus10043073.BGIv1.0 annot-version=v1.0 MEENNPNFAPATSGRQSVKAKSLEKQDQESIKSALQGIVSDELKRIRQPSSVDDDDDDDNNKKLLNAPNLLSTMMICYGSTTACMMLMTVIAKRYCWRCN GSSMRISRKNQI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10043073 [exp]	0	1
AT5G17070			unknown protein		Lus10008757 [exp]	1.7	0.8586
					Lus10033298 [exp]	8.8	0.8422
AT5G17460			unknown protein		Lus10009117 [exp]	11.5	0.8233
AT4G12020	WRKY	MEKK4, MAPKKK11...	MAPK/ERK KINASE KINASE 4, MITO...		Lus10016282 [exp]	14.5	0.8116
AT4G31580		SRZ22, RSZP22, ...	RS-containing zinc finger prot...		Lus10020123 [exp]	16.6	0.7985
AT4G16580			Protein phosphatase 2C family ...		Lus10016309 [exp]	18.5	0.8150
AT2G44770			ELMO/CED-12 family protein (.1...		Lus10003841 [exp]	21.0	0.8105
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Lus10012040 [exp]	21.3	0.8235
AT5G54520			Transducin/WD40 repeat-like su...		Lus10014805 [exp]	24.5	0.8091
AT5G51410			LUC7 N_terminus domain-contain...		Lus10031732 [exp]	24.8	0.8323

Compare expression of checked genes

Lus10043073 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.