Lus10043081 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17930 63 / 6e-12 Aminotransferase-like, plant mobile domain family protein (.1)
AT2G04865 62 / 1e-11 Aminotransferase-like, plant mobile domain family protein (.1)
AT2G25010 60 / 5e-11 Aminotransferase-like, plant mobile domain family protein (.1)
AT1G48120 48 / 7e-07 hydrolases;protein serine/threonine phosphatases (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020970 218 / 1e-69 AT1G17930 123 / 2e-30 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10027047 213 / 5e-67 AT1G17930 119 / 1e-28 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10000686 196 / 1e-64 AT1G17930 87 / 3e-20 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10001981 197 / 3e-64 AT1G17930 61 / 2e-10 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10012087 162 / 2e-50 AT1G17930 57 / 4e-09 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10000980 156 / 2e-49 AT1G17930 56 / 9e-10 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10021566 158 / 2e-48 AT1G17930 54 / 4e-08 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10024265 155 / 1e-47 AT1G17930 59 / 9e-10 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10033313 149 / 4e-44 AT1G17930 72 / 1e-13 Aminotransferase-like, plant mobile domain family protein (.1)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10536 PMD Plant mobile domain
Representative CDS sequence
>Lus10043081 pacid=23168309 polypeptide=Lus10043081 locus=Lus10043081.g ID=Lus10043081.BGIv1.0 annot-version=v1.0
ATGAGACTGCCTATAAGGTATGCTGATCGTTCCCGTCTAGTGGGTTGGGAGTACTTCTTGGGGGTAGCCTGTGAGATACCAGGGTACGCTTGGGGTTCTA
GTGTCTTAGCTTGGTTGTACGGCGAGCTCGGCAAGACTAGTCGTGTCGATGCGAAGGGGATGACAGGTTGTATTACTTTATTCCAGCCCTGGATTTACGA
GTACTTTCCTAGAGTTAGGCCTGCTAGGATGGTGCGACTGAAGCGTAGAGCGGTTCATGCGTTAGCTGGTAGATGGGACAGTGCCCAAAAGCTGAGTAGG
GCAGGTGGAGTCTTACAAGAAAGGCTGGACTACTACCGTCACCTCCTTGATGGCATGGATCCTCGTGACGTGACTTGGCTTCCGTTTGGTCCACACCCCG
CCATCGATGATCCTAAGGCGACTTTTCGTGGACTTATTCGTTGTGCCGATGTTGGGGAGTACGGCGATTCCTACCACGGGCTCAGATAG
AA sequence
>Lus10043081 pacid=23168309 polypeptide=Lus10043081 locus=Lus10043081.g ID=Lus10043081.BGIv1.0 annot-version=v1.0
MRLPIRYADRSRLVGWEYFLGVACEIPGYAWGSSVLAWLYGELGKTSRVDAKGMTGCITLFQPWIYEYFPRVRPARMVRLKRRAVHALAGRWDSAQKLSR
AGGVLQERLDYYRHLLDGMDPRDVTWLPFGPHPAIDDPKATFRGLIRCADVGEYGDSYHGLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17930 Aminotransferase-like, plant m... Lus10043081 0 1

Lus10043081 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.