Lus10043087 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07840 268 / 3e-89 Pectin lyase-like superfamily protein (.1)
AT3G07820 268 / 4e-89 Pectin lyase-like superfamily protein (.1)
AT5G48140 263 / 6e-87 Pectin lyase-like superfamily protein (.1)
AT3G07830 250 / 3e-82 Pectin lyase-like superfamily protein (.1)
AT3G14040 234 / 3e-75 Pectin lyase-like superfamily protein (.1)
AT3G07850 232 / 2e-74 Pectin lyase-like superfamily protein (.1)
AT4G18180 221 / 1e-70 Pectin lyase-like superfamily protein (.1)
AT1G78400 199 / 3e-62 Pectin lyase-like superfamily protein (.1)
AT1G17150 196 / 4e-61 Pectin lyase-like superfamily protein (.1)
AT2G33160 198 / 1e-59 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043088 418 / 2e-148 AT3G07820 360 / 6e-123 Pectin lyase-like superfamily protein (.1)
Lus10039154 282 / 2e-94 AT5G48140 335 / 8e-113 Pectin lyase-like superfamily protein (.1)
Lus10013784 277 / 2e-92 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1)
Lus10013780 277 / 2e-92 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1)
Lus10009606 263 / 6e-87 AT3G07840 323 / 4e-108 Pectin lyase-like superfamily protein (.1)
Lus10003001 270 / 5e-86 AT3G07840 362 / 1e-118 Pectin lyase-like superfamily protein (.1)
Lus10009605 263 / 1e-84 AT3G07840 317 / 1e-102 Pectin lyase-like superfamily protein (.1)
Lus10041058 254 / 6e-83 AT3G07830 311 / 1e-102 Pectin lyase-like superfamily protein (.1)
Lus10041059 254 / 7e-83 AT3G07830 310 / 1e-102 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G067166 296 / 4e-100 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067200 296 / 4e-100 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067133 296 / 4e-100 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067100 292 / 1e-98 AT3G07820 404 / 5e-140 Pectin lyase-like superfamily protein (.1)
Potri.019G066800 290 / 2e-97 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067000 290 / 2e-97 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067050 290 / 2e-97 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1)
Potri.007G035800 261 / 1e-86 AT3G07820 350 / 7e-119 Pectin lyase-like superfamily protein (.1)
Potri.009G169100 228 / 7e-73 AT4G18180 563 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.014G162300 208 / 2e-66 AT3G07850 358 / 3e-122 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10043087 pacid=23167906 polypeptide=Lus10043087 locus=Lus10043087.g ID=Lus10043087.BGIv1.0 annot-version=v1.0
ATGAATGATGGGCTTGTGGAAGGGATAACAAGCAAAGACAGCAAGAACTTCCACGTCAATGTTCTAGGGAGCAAGAACTTCACATTCAGCAAGTTCACAG
TGGTGGCTCCCGGAAACAGCCCCAACACCGACGGAATCCACATGGGCAGATCCACTGACATTAAGATTCTCGACACATCCATTTCGACAGGGGACGATTG
CATCTCGATCAGAAATGGGTTGGAGCAACTAACGGTGGAAAGAGTCACTTGCGGTCCGGGACATGGTATCGCGGTTGGAAGTCTGGGACGTTACCCGAAT
GAGGCGCCCGTTAAGGGAATCTTCGTCAAGAACTGCACCTTGAAAGGGACCACCAACGGGGTGAGAATCAAGACGTGGCCCCATTTCGAGGATATCGTGT
TGGAAGATGTGTTCAACCCTATCATAATCGACCAAGTATACTGCCCGTGGAATAAGTGCAAATCGAAGGCGCCGTCCAAGGTGACGATTAGTAATGTTAG
CTTTAAGAACATAAGAGGAACGAGCAGGTGTGTGGAAGCGATAAAGATAGATTGTAGCCCAGCACATCCTTGTAAGAATGTTGAACTGGCTGGTATTGAC
ATCAAGGCTATTGATGGTCCTGCTGCTATAGCAGTTTGCAACAATGTTAAGCCAATTATCACTGGTATTGTTAATCCTCCTGACTGTCAGTAA
AA sequence
>Lus10043087 pacid=23167906 polypeptide=Lus10043087 locus=Lus10043087.g ID=Lus10043087.BGIv1.0 annot-version=v1.0
MNDGLVEGITSKDSKNFHVNVLGSKNFTFSKFTVVAPGNSPNTDGIHMGRSTDIKILDTSISTGDDCISIRNGLEQLTVERVTCGPGHGIAVGSLGRYPN
EAPVKGIFVKNCTLKGTTNGVRIKTWPHFEDIVLEDVFNPIIIDQVYCPWNKCKSKAPSKVTISNVSFKNIRGTSRCVEAIKIDCSPAHPCKNVELAGID
IKAIDGPAAIAVCNNVKPIITGIVNPPDCQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07840 Pectin lyase-like superfamily ... Lus10043087 0 1
AT2G39380 ATEXO70H2 exocyst subunit exo70 family p... Lus10005435 2.0 0.8671
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10026623 3.2 0.8410
AT5G04220 SYT3, NTMCTYPE1... synaptotagmin 3, Calcium-depen... Lus10009226 8.1 0.8462
AT1G52560 HSP20-like chaperones superfam... Lus10023653 8.5 0.8670
AT1G77380 AAP3, ATAAP3 amino acid permease 3 (.1) Lus10042741 9.5 0.8402
AT3G02125 unknown protein Lus10013196 11.0 0.8369
AT2G29090 CYP707A2 "cytochrome P450, family 707, ... Lus10016515 11.2 0.8404
AT3G02230 ATRGP1, RGP1 ARABIDOPSIS THALIANA REVERSIBL... Lus10034376 13.0 0.8304
Lus10005955 15.4 0.8262
AT2G43820 SGT1, ATSAGT1, ... UDP-glucose:salicylic acid glu... Lus10017826 17.2 0.8336

Lus10043087 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.