Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15518 61 / 2e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032656 [exp] 168 / 2e-55 AT3G15518 65 / 1e-14 unknown protein Lus10037893 [exp] 61 / 3e-13 AT3G15518 64 / 2e-14 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G123600 [exp] 64 / 2e-14 AT3G15518 64 / 2e-14 unknown protein Potri.001G404500 [exp] 61 / 2e-13 AT3G15518 66 / 2e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043096 pacid=23168315 polypeptide=Lus10043096 locus=Lus10043096.g ID=Lus10043096.BGIv1.0 annot-version=v1.0 ATGGGCGGTATTGATGTGGCGCAGTCGGCGGAAGGGAGCCGTCGAGGGGGCGGCAGAAGTAGTAATTACACCAGTGGCGGCGTTGTTCGCGGAGGAGGAG CGTTTTCGGCGAGGGCGATGAGGACGTCGGCCGCCGGCAGGTGCGGGAGCGTCCGGCAGCAACGTAGCCCCATCCCACCAAGTAGCAGGATTCGGCATCA TCATCAGGCGGCGGGTAATAGAGAGGTGTTGAGAAGGGCCTTGATGCCGCCCAGTCGGCGGCCTAGTCTCCGGTGGGTGAATTTCCGGCCTTCCCCTAGT CGTCTATGCAACATGTCAATGGCCCCCTGA
AA sequence Show only first row Show all	>Lus10043096 pacid=23168315 polypeptide=Lus10043096 locus=Lus10043096.g ID=Lus10043096.BGIv1.0 annot-version=v1.0 MGGIDVAQSAEGSRRGGGRSSNYTSGGVVRGGGAFSARAMRTSAAGRCGSVRQQRSPIPPSSRIRHHHQAAGNREVLRRALMPPSRRPSLRWVNFRPSPS RLCNMSMAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15518			unknown protein		Lus10043096 [exp]	0	1
AT5G01250			alpha 1,4-glycosyltransferase ...		Lus10027770 [exp]	10.5	0.9546
AT1G74360			Leucine-rich repeat protein ki...		Lus10003477 [exp]	15.0	0.9505
AT3G48180			unknown protein		Lus10043469 [exp]	18.2	0.9545
AT4G04450	WRKY	ATWRKY42, WRKY4...	WRKY family transcription fact...		Lus10020023 [exp]	24.5	0.9527
AT5G39120			RmlC-like cupins superfamily p...		Lus10006538 [exp]	25.4	0.9524
AT3G59080			Eukaryotic aspartyl protease f...		Lus10007335 [exp]	26.9	0.9258
AT5G58620	C3HZnF		zinc finger (CCCH-type) family...		Lus10018243 [exp]	27.3	0.9496
AT1G01480		AT-ACC2, ACS2	1-amino-cyclopropane-1-carboxy...		Lus10032301 [exp]	28.0	0.9408
AT3G49050			alpha/beta-Hydrolases superfam...		Lus10030391 [exp]	32.2	0.9247
AT1G60680		AGD2	NAD(P)-linked oxidoreductase s...		Lus10004399 [exp]	32.5	0.9493

Compare expression of checked genes

Lus10043096 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.