Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025323 [exp] 50 / 1e-09 ND / Lus10013671 [exp] 49 / 5e-09 ND / Lus10017532 [exp] 48 / 1e-07 AT1G64080 175 / 1e-49 MEMBRANE-ASSOCIATED KINASE REGULATOR 2, unknown protein Lus10029356 [exp] 45 / 2e-07 ND / Lus10022980 [exp] 46 / 3e-07 ND / Lus10034512 [exp] 45 / 4e-07 ND / Lus10036650 [exp] 44 / 8e-07 ND / Lus10012643 [exp] 45 / 1e-06 ND / Lus10036279 [exp] 45 / 1e-06 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043100 pacid=23168349 polypeptide=Lus10043100 locus=Lus10043100.g ID=Lus10043100.BGIv1.0 annot-version=v1.0 ATGCTTGTAATCGGGAGTGGCGTGACATCCGCCGCAACAAGTGCCCAGTTGTTCCTTCTGCAAACTGGATTCATTCTCGAGAAACATGACGCCGAAGTTG AGAAATACTTCAAATGCCCTTTCTATAAGTGTAAGTTCAAGAAGAAGTTGGAGGTGGTGTTGGCTGAGAACTCGGTGAGGCGCGAGATGAGAGCTACAAT GGAGGCGAAAGTTACTGAGAAGGATGCTGAAATTGAAGCTGCTCGTGCTAAAATGCAAGCTGCTCGTGCTGAAGGATAG
AA sequence Show only first row Show all	>Lus10043100 pacid=23168349 polypeptide=Lus10043100 locus=Lus10043100.g ID=Lus10043100.BGIv1.0 annot-version=v1.0 MLVIGSGVTSAATSAQLFLLQTGFILEKHDAEVEKYFKCPFYKCKFKKKLEVVLAENSVRREMRATMEAKVTEKDAEIEAARAKMQAARAEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10043100 [exp]	0	1
AT2G44450		BGLU15	beta glucosidase 15 (.1)		Lus10026057 [exp]	1.4	0.9981
					Lus10038642 [exp]	1.7	0.9848
					Lus10032696 [exp]	2.0	0.9949
					Lus10022993 [exp]	5.0	0.9629
					Lus10002291 [exp]	7.9	0.9440
AT4G18060			SH3 domain-containing protein ...		Lus10025372 [exp]	13.6	0.8376
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Lus10003481 [exp]	14.4	0.9764
AT5G01370		ACI1	ALC-interacting protein 1 (.1)		Lus10001252 [exp]	15.1	0.8734
					Lus10032968 [exp]	19.0	0.9457
AT5G08370		ATAGAL2	alpha-galactosidase 2 (.1.2)		Lus10038325 [exp]	19.1	0.9216

Compare expression of checked genes

Lus10043100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.