Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043115 pacid=23168045 polypeptide=Lus10043115 locus=Lus10043115.g ID=Lus10043115.BGIv1.0 annot-version=v1.0 ATGAAACTCAACAAGATCAAAGAAACAGACAAGGTCTCCAAGCCTAAATATGATGTTAGTTCTCGTAACAAGACCAAGAAGTTGCAAAAGATATTAGATA TGAACAAGTACAGTTACCATCTTGAAGCTCCATTGCTCAGCATTCTCAATATCAACAATGAACATAAAAAGAAGAAGGAAAATGGAACAGACGGGAAAAG ATGGATACTTACTCTTTTCTGCCACGACAGGAAAACTGAAATCGCTACTTTACTCGTCGGAAGTAGAGGAGAGCCGTGGAGGCTCGCGTAA
AA sequence Show only first row Show all	>Lus10043115 pacid=23168045 polypeptide=Lus10043115 locus=Lus10043115.g ID=Lus10043115.BGIv1.0 annot-version=v1.0 MKLNKIKETDKVSKPKYDVSSRNKTKKLQKILDMNKYSYHLEAPLLSILNINNEHKKKKENGTDGKRWILTLFCHDRKTEIATLLVGSRGEPWRLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10043115 [exp]	0	1
AT2G02340		ATPP2-B8	phloem protein 2-B8 (.1)		Lus10018175 [exp]	7.2	0.7079
					Lus10022880 [exp]	11.6	0.7118
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10030086 [exp]	12.0	0.6885
AT5G60740		ABCG28	ATP-binding cassette G28, ABC ...		Lus10016115 [exp]	16.2	0.7008
AT5G22260		MS1	male sterility 1, RING/FYVE/PH...		Lus10030773 [exp]	17.4	0.7018
AT5G39210		CRR7	chlororespiratory reduction 7 ...		Lus10032982 [exp]	29.4	0.6991
AT3G51810		AT3, GEA1, ATEM...	GUANINE NUCLEOTIDE EXCHANGE FA...		Lus10005044 [exp]	30.9	0.6494
					Lus10013687 [exp]	32.5	0.6594
AT1G26750			unknown protein		Lus10031376 [exp]	43.1	0.6804
AT5G04280		AtRZ-1c	AtRZ-1c, RNA-binding (RRM/RBD/...		Lus10038683 [exp]	44.1	0.6628

Compare expression of checked genes

Lus10043115 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.