Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27260 51 / 2e-08 unknown protein AT2G24960 51 / 3e-08 unknown protein AT4G02210 48 / 3e-07 unknown protein AT1G30140 44 / 7e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032816 [exp] 193 / 4e-64 AT2G24960 57 / 1e-09 unknown protein Lus10010798 [exp] 202 / 5e-64 AT5G27260 61 / 5e-10 unknown protein Lus10018174 [exp] 191 / 1e-61 AT5G41980 68 / 1e-12 unknown protein Lus10022379 [exp] 129 / 2e-37 AT5G27260 74 / 1e-14 unknown protein Lus10004397 [exp] 126 / 3e-36 AT5G27260 77 / 6e-16 unknown protein Lus10026427 [exp] 122 / 5e-36 ND / Lus10013131 [exp] 108 / 5e-32 ND 35 / 0.004 Lus10006034 [exp] 108 / 7e-30 AT5G27260 42 / 2e-04 unknown protein Lus10024284 [exp] 105 / 7e-30 AT5G27260 50 / 2e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G265900 [exp] 51 / 2e-08 AT2G24960 761 / 0.0 unknown protein Potri.012G061366 [exp] 50 / 3e-08 AT4G02550 71 / 2e-14 unknown protein Potri.001G157750 [exp] 50 / 5e-08 AT4G02550 73 / 6e-15 unknown protein Potri.003G047151 [exp] 50 / 5e-08 AT4G02550 69 / 3e-13 unknown protein Potri.011G163248 [exp] 49 / 7e-08 AT4G02550 93 / 4e-22 unknown protein Potri.006G196716 [exp] 49 / 7e-08 AT4G02550 69 / 2e-13 unknown protein Potri.002G200600 [exp] 49 / 9e-08 AT4G02210 471 / 1e-163 unknown protein Potri.011G088750 [exp] 49 / 1e-07 AT4G02550 79 / 3e-17 unknown protein Potri.010G215600 [exp] 49 / 1e-07 AT4G02550 77 / 7e-16 unknown protein Potri.009G022650 [exp] 49 / 1e-07 AT4G02550 79 / 7e-17 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043125 pacid=23168442 polypeptide=Lus10043125 locus=Lus10043125.g ID=Lus10043125.BGIv1.0 annot-version=v1.0 ATGATGCATACGAAGATTGAAAACTACACCTCGTTGGTTGTTCCACATATCAATTCCAAGGTCCAATATTTCAAGGATAAGTTCACTACGGTACTAGAAC TCCAGCAAACTAGTGGATTTGGTTGGGATGATGCTCGTGGTTGTATAGTTGCAGATCCAGCCATCTTCGTTGGCTGGGTGAAGGGGCATCCTAAAGCGAA ATGGATGAACAATAAGCCACTTCCTTTTTGGGAAGAATTTTGCTTTATATTTGGGGTAGATCATGCACTTGGTTTGGATGCTGCCCAACCTTTAGATGCA GCAAGCAAAATGTTGTCAAGTGCCAGCGCCTCTTATTTCGGGGATGAAGTAATCGAGAGACCTGATTCGTAG
AA sequence Show only first row Show all	>Lus10043125 pacid=23168442 polypeptide=Lus10043125 locus=Lus10043125.g ID=Lus10043125.BGIv1.0 annot-version=v1.0 MMHTKIENYTSLVVPHINSKVQYFKDKFTTVLELQQTSGFGWDDARGCIVADPAIFVGWVKGHPKAKWMNNKPLPFWEEFCFIFGVDHALGLDAAQPLDA ASKMLSSASASYFGDEVIERPDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G24960			unknown protein		Lus10043125 [exp]	0	1

Compare expression of checked genes

Lus10043125 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.