Plant FIBer expression Database

Lus10043143 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04620 163 / 5e-50 HCAR 7-hydroxymethyl chlorophyll a \(HMChl\) reductase, coenzyme F420 hydrogenase family / dehydrogenase, beta subunit family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043145
[exp]
200 / 5e-64 AT1G04620 767 / 0.0 7-hydroxymethyl chlorophyll a \(HMChl\) reductase, coenzyme F420 hydrogenase family / dehydrogenase, beta subunit family (.1)
Lus10032607
[exp]
196 / 2e-62 AT1G04620 773 / 0.0 7-hydroxymethyl chlorophyll a \(HMChl\) reductase, coenzyme F420 hydrogenase family / dehydrogenase, beta subunit family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G062300
[exp]
171 / 6e-53 AT1G04620 775 / 0.0 7-hydroxymethyl chlorophyll a \(HMChl\) reductase, coenzyme F420 hydrogenase family / dehydrogenase, beta subunit family (.1)
PFAM info
Representative CDS sequence
>Lus10043143 pacid=23168067 polypeptide=Lus10043143 locus=Lus10043143.g ID=Lus10043143.BGIv1.0 annot-version=v1.0
ATGGAGACTGTCAAGGCAGATGACAACGCAAAGCTAGGAAAGGGTCCTGCTCAACCTGCTCCAAAGCTTGTTGGAAACCTGATTGCTTTTATACTCAACT
TGGTCGGGCCAAAGGGTCTTGAATTTGCTCGGTATTCACTTGACTACCATACGATACGGAACTATTTGTACACGAACCGTATTTGGGGGAAAGAAAGAGC
TGCCAGACACACCCCTTCTTATGCGAAGAAACTTGTCGAACTTTACAACCAGAACGGGGAAATCGATCAGATGTTAAAAATGAAGTGA
AA sequence
>Lus10043143 pacid=23168067 polypeptide=Lus10043143 locus=Lus10043143.g ID=Lus10043143.BGIv1.0 annot-version=v1.0
METVKADDNAKLGKGPAQPAPKLVGNLIAFILNLVGPKGLEFARYSLDYHTIRNYLYTNRIWGKERAARHTPSYAKKLVELYNQNGEIDQMLKMK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04620 HCAR 7-hydroxymethyl chlorophyll a ... Lus10043143
[exp]
0 1
AT5G16810 Protein kinase superfamily pro... Lus10040743
[exp]
1.0 0.9765
AT5G13410 FKBP-like peptidyl-prolyl cis-... Lus10040937
[exp]
4.2 0.9467
AT5G39830 DEG8, DEGP8 DEG PROTEASE 8, Trypsin family... Lus10007262
[exp]
6.0 0.9557
AT2G35500 SKL2 shikimate kinase-like 2, shiki... Lus10035389
[exp]
6.3 0.9408
AT5G16810 Protein kinase superfamily pro... Lus10016488
[exp]
6.7 0.9435
AT5G44520 NagB/RpiA/CoA transferase-like... Lus10008059
[exp]
7.0 0.9488
AT5G11450 PPD5 PsbP domain protein 5, Mog1/Ps... Lus10001861
[exp]
7.3 0.9627
AT5G48830 unknown protein Lus10038165
[exp]
7.4 0.9447
AT3G25470 bacterial hemolysin-related (.... Lus10008746
[exp]
7.4 0.9529
AT4G39710 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex... Lus10016811
[exp]
9.4 0.9540

Lus10043143 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.