Lus10043144 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04610 285 / 5e-96 YUC3 YUCCA 3 (.1)
AT2G33230 256 / 9e-85 YUC7 YUCCA 7 (.1)
AT5G43890 236 / 5e-77 YUCCA5, SUPER1, YUC5 YUCCA5, SUPPRESSOR OF ER 1, Flavin-binding monooxygenase family protein (.1)
AT1G04180 235 / 8e-77 YUC9 YUCCA 9 (.1)
AT4G28720 235 / 1e-76 YUC8 YUCCA 8, Flavin-binding monooxygenase family protein (.1)
AT5G25620 196 / 1e-61 YUC6 YUCCA6, Flavin-binding monooxygenase family protein (.1.2)
AT5G11320 195 / 2e-61 YUC4 YUCCA4, Flavin-binding monooxygenase family protein (.1.2)
AT4G32540 181 / 6e-56 YUC1, YUC YUCCA 1, YUCCA, Flavin-binding monooxygenase family protein (.1)
AT4G13260 173 / 1e-52 YUC2 YUCCA2, Flavin-binding monooxygenase family protein (.1)
AT1G48910 134 / 6e-38 YUC10 YUCCA 10, Flavin-containing monooxygenase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043142 365 / 4e-128 AT1G04610 599 / 0.0 YUCCA 3 (.1)
Lus10032608 335 / 4e-118 AT1G04610 320 / 9e-109 YUCCA 3 (.1)
Lus10023695 311 / 5e-106 AT1G04610 692 / 0.0 YUCCA 3 (.1)
Lus10035244 298 / 4e-101 AT1G04610 692 / 0.0 YUCCA 3 (.1)
Lus10000494 249 / 1e-84 AT4G28720 318 / 2e-108 YUCCA 8, Flavin-binding monooxygenase family protein (.1)
Lus10022851 248 / 1e-81 AT4G28720 666 / 0.0 YUCCA 8, Flavin-binding monooxygenase family protein (.1)
Lus10011274 223 / 6e-72 AT4G28720 643 / 0.0 YUCCA 8, Flavin-binding monooxygenase family protein (.1)
Lus10008092 195 / 3e-61 AT5G11320 575 / 0.0 YUCCA4, Flavin-binding monooxygenase family protein (.1.2)
Lus10013125 192 / 6e-60 AT5G11320 579 / 0.0 YUCCA4, Flavin-binding monooxygenase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G174600 302 / 5e-103 AT1G04610 686 / 0.0 YUCCA 3 (.1)
Potri.010G062400 276 / 1e-91 AT1G04610 657 / 0.0 YUCCA 3 (.1)
Potri.002G254200 260 / 1e-86 AT4G28720 694 / 0.0 YUCCA 8, Flavin-binding monooxygenase family protein (.1)
Potri.006G243400 201 / 2e-63 AT5G25620 608 / 0.0 YUCCA6, Flavin-binding monooxygenase family protein (.1.2)
Potri.018G036800 200 / 6e-63 AT5G25620 576 / 0.0 YUCCA6, Flavin-binding monooxygenase family protein (.1.2)
Potri.006G248200 198 / 1e-62 AT5G11320 598 / 0.0 YUCCA4, Flavin-binding monooxygenase family protein (.1.2)
Potri.007G028200 195 / 4e-61 AT5G25620 495 / 5e-175 YUCCA6, Flavin-binding monooxygenase family protein (.1.2)
Potri.018G033200 175 / 2e-53 AT5G11320 546 / 0.0 YUCCA4, Flavin-binding monooxygenase family protein (.1.2)
Potri.005G186100 142 / 3e-41 AT1G21430 448 / 2e-157 Flavin-binding monooxygenase family protein (.1)
Potri.002G207400 132 / 4e-37 AT1G48910 429 / 3e-150 YUCCA 10, Flavin-containing monooxygenase family protein (.1)
PFAM info
Representative CDS sequence
>Lus10043144 pacid=23167949 polypeptide=Lus10043144 locus=Lus10043144.g ID=Lus10043144.BGIv1.0 annot-version=v1.0
ATGAAGTGGATGCCGTTGTGGATGGTGGACAAAGTACTGCTGGGTTTCACGAGGGTGATTTTGGGGAATCAGGAGAAGTACGGTCTGAAAAGGCCACAGA
TCGGGCCACTGGAGCTGAAGAACATCCAAGGCAAGACGCCTGTTTTGGACATTGGGGCGTTGGCCAAGATACGATCCGGCCAAGTCAAGGTTGTCCCCGG
TATCAACAAGTTCACTAATAATACCAAAGTTGAGCTCGTCAACGGCGAGATTCTGGAGATTGATTCTGTGATTTTGGCAACTGGGTATCGCAGCAATGTT
CCTTCTTGGCTAAAGGAGAACGAGTTTTTTTCGGAAGATGGAGTGCCAAAGGATCCATTCCCAAACGGGTGGAAAGGGAAAGCAGGGCTGTACGCAGTTG
GGTTCACAGGGAAAGGGCTATCAGGTGCTTCTCTTGACGCCATTAGTGTGGCGCTTGACATTGCTAAGAGCTGGAGAGAAGATACTAAACAGAAGAAGAA
GACCATGGCTGCCAAGCACAGGAGATGCATCTCTCATTTCTGA
AA sequence
>Lus10043144 pacid=23167949 polypeptide=Lus10043144 locus=Lus10043144.g ID=Lus10043144.BGIv1.0 annot-version=v1.0
MKWMPLWMVDKVLLGFTRVILGNQEKYGLKRPQIGPLELKNIQGKTPVLDIGALAKIRSGQVKVVPGINKFTNNTKVELVNGEILEIDSVILATGYRSNV
PSWLKENEFFSEDGVPKDPFPNGWKGKAGLYAVGFTGKGLSGASLDAISVALDIAKSWREDTKQKKKTMAAKHRRCISHF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04610 YUC3 YUCCA 3 (.1) Lus10043144 0 1
AT1G04610 YUC3 YUCCA 3 (.1) Lus10043142 2.4 0.9091
AT2G17080 Arabidopsis protein of unknown... Lus10023957 7.9 0.8880
AT3G56230 BTB/POZ domain-containing prot... Lus10010216 13.7 0.8888
AT2G12646 PLATZ transcription factor fam... Lus10008814 24.2 0.8868
AT2G35730 Heavy metal transport/detoxifi... Lus10000263 24.3 0.7754
AT1G06290 ATACX3, ACX3 acyl-CoA oxidase 3 (.1) Lus10016249 26.0 0.8854
AT2G17080 Arabidopsis protein of unknown... Lus10025120 27.1 0.8800
AT2G17080 Arabidopsis protein of unknown... Lus10023965 27.5 0.8861
AT3G48280 CYP71A25 "cytochrome P450, family 71, s... Lus10002885 28.6 0.8703
AT1G01470 LSR3, LEA14 LIGHT STRESS-REGULATED 3, LATE... Lus10010139 30.4 0.8747

Lus10043144 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.