Lus10043152 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13450 130 / 4e-37 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT2G03720 71 / 3e-15 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT5G17390 64 / 6e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G03290 63 / 2e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G69080 59 / 2e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT1G44760 59 / 2e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032598 353 / 1e-124 AT4G13450 177 / 7e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10014459 323 / 5e-113 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10023716 223 / 6e-75 AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10034661 61 / 4e-11 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10019173 58 / 5e-10 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10036814 52 / 1e-08 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10029664 54 / 2e-08 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10042701 53 / 2e-08 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10007982 53 / 3e-08 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G064800 151 / 1e-45 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.010G140200 59 / 3e-10 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.015G060700 58 / 4e-10 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.008G109000 58 / 6e-10 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.T170801 58 / 6e-10 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.002G084600 55 / 6e-09 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.005G177100 54 / 9e-09 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10043152 pacid=23168101 polypeptide=Lus10043152 locus=Lus10043152.g ID=Lus10043152.BGIv1.0 annot-version=v1.0
ATGGGAACGTCGTCGATGAGGAAAGTAATGGTGGTGGTGGATCCAAGCAGAGAGGCTGCCGGAGCGCTTCAATACGCATTGTCCCACGTCGTAACTGAGA
AAGATGAGCTCATTCTGGTCCACGTCGAAACTCAAAATTCATGGAAGAACACCCTGACTTTCTCATTCCTTCGTCGATCGGGCATCTCAATTCCGGCCAT
CAATAACAACAACAACAACAACAATAATAATAATAATGTTAACATCAATAATAATAATAATAATAATCAGACATGTTCGACATCATCGGTGGCGGAAGGA
GGAGGAGGAGGGGGTGGCGGAGGAGTTAACGGCGGCGCTGGAGGAGGAGGAGGAGGAGGAGAAGGGGAGGTTGATTTTTTGGAAGCGATGAAGCAGTTAT
GCGAGGCAGCAAAGCCAAGGCTGAAAGTGAAGGTGGAGAGGCTGCAAATGGGAGCAAGGGACAAAGCTAGCGTCATTCTGTTCAAGAGCACTTCCATGGC
GGTCGACCATCTCATCATTGGCCAAAAGAAGAACCTCTCCAGCATCTTATTAGGGACCAGCAAATACAAGAAACCAGGAGGAATGGGGCCAAAGTCACTG
GACATGGCAGAGTATTTGATCGAGTACAGCAAGTGCAATTGTGTTGGGGTGCAGAAGAAGGGGCAAAGTGGAGGTTACCTTCTCAACACTAAGACCCAGA
AGAATTTTTGGCTCCTTGCTTAG
AA sequence
>Lus10043152 pacid=23168101 polypeptide=Lus10043152 locus=Lus10043152.g ID=Lus10043152.BGIv1.0 annot-version=v1.0
MGTSSMRKVMVVVDPSREAAGALQYALSHVVTEKDELILVHVETQNSWKNTLTFSFLRRSGISIPAINNNNNNNNNNNNVNINNNNNNNQTCSTSSVAEG
GGGGGGGGVNGGAGGGGGGGEGEVDFLEAMKQLCEAAKPRLKVKVERLQMGARDKASVILFKSTSMAVDHLIIGQKKNLSSILLGTSKYKKPGGMGPKSL
DMAEYLIEYSKCNCVGVQKKGQSGGYLLNTKTQKNFWLLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G13450 Adenine nucleotide alpha hydro... Lus10043152 0 1

Lus10043152 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.