Lus10043162 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55640 163 / 1e-52 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G367200 169 / 4e-55 AT5G55640 146 / 1e-45 unknown protein
PFAM info
Representative CDS sequence
>Lus10043162 pacid=23168299 polypeptide=Lus10043162 locus=Lus10043162.g ID=Lus10043162.BGIv1.0 annot-version=v1.0
ATGTTAGATACCGATGGGTTCGTAATTCCAAGCTTGGGAATCGAAAACAGAGATCAATCTACACATAATGATTCAGAAATAGACGCCTTGAAACCTCCTT
CTCCAAAGGCTAAAAAGGAAGAACACATTTACCTAGGTCCTCACGGGGCGCCACCTTCACAATTAAAGCATCAAGAACTGAACTTGTCGAACCGGAAACA
ACGGTTTAAGCAGAAGCTGAAGGATGCTGATAAGAGGATCAGCGGAACAGGGCGCGAGAATAAGTTGGAGAATCTGCAGGAACTAGTTGGCGGAGAAGCG
AAAACAGGCACAAACAACTTGTTGAAGAGCTCTCCTAAGGATTGGCTAGACCCACATTGCGATGAATCCCAGTTTGAGAAGCGGCATCCCCGGTGA
AA sequence
>Lus10043162 pacid=23168299 polypeptide=Lus10043162 locus=Lus10043162.g ID=Lus10043162.BGIv1.0 annot-version=v1.0
MLDTDGFVIPSLGIENRDQSTHNDSEIDALKPPSPKAKKEEHIYLGPHGAPPSQLKHQELNLSNRKQRFKQKLKDADKRISGTGRENKLENLQELVGGEA
KTGTNNLLKSSPKDWLDPHCDESQFEKRHPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55640 unknown protein Lus10043162 0 1
AT2G15910 CSL zinc finger domain-contain... Lus10023841 1.4 0.8317
AT5G40370 GRXC2 glutaredoxin C2, Glutaredoxin ... Lus10013089 5.5 0.7954
AT2G32520 alpha/beta-Hydrolases superfam... Lus10035287 7.9 0.7795
AT5G48580 FKBP15-2 FK506- and rapamycin-binding p... Lus10035800 8.1 0.7929
AT5G04000 unknown protein Lus10018038 8.9 0.7919
AT3G52770 ZPR3 LITTLE ZIPPER 3, protein bindi... Lus10017055 9.8 0.7618
AT1G55805 BolA-like family protein (.1) Lus10002318 11.7 0.7922
AT4G18372 Small nuclear ribonucleoprotei... Lus10000241 12.2 0.7561
AT3G55820 Fasciclin-like arabinogalactan... Lus10040220 13.6 0.6731
AT2G40780 Nucleic acid-binding, OB-fold-... Lus10029014 14.3 0.7208

Lus10043162 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.