Lus10043166 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16447 40 / 5e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032581 214 / 7e-73 ND 40 / 7e-05
Lus10004411 101 / 2e-28 ND 37 / 9e-04
Lus10004778 57 / 1e-11 ND /
Lus10006375 44 / 8e-06 ND 42 / 4e-05
Lus10012330 43 / 1e-05 ND 40 / 2e-04
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G362000 94 / 8e-26 AT4G16447 50 / 8e-09 unknown protein
Potri.011G086300 62 / 3e-13 AT4G16447 40 / 6e-05 unknown protein
Potri.014G165000 61 / 1e-12 AT4G16447 43 / 5e-06 unknown protein
Potri.006G016500 60 / 3e-12 AT4G16447 46 / 5e-07 unknown protein
Potri.016G009200 40 / 9e-05 AT4G16447 44 / 2e-06 unknown protein
PFAM info
Representative CDS sequence
>Lus10043166 pacid=23167918 polypeptide=Lus10043166 locus=Lus10043166.g ID=Lus10043166.BGIv1.0 annot-version=v1.0
ATGGATAGGCAAAGCTCTACTGAACCAACCATCGCCAAGTCTTCTTCCATTGCATTGCTTCAGGAGAGGTTTCGGACGCTAGAGCGAGCTAGGGAGATGA
GGCGACAGAGGCAGTTGTTCCGAGTCTTTCCCGAGGCCGACCACGAGAAATCAGATGCATCATCGCCTTCCATTTACTTTCGGGGCTCCCGACTCATCGT
TCCTGACAAACCAGCACTGATCAGAGACTCATCTCTGCAGCTGCAATATCCAACAATGCAGCCGGGACAATACGCTGGTTTTCGAGTCGACGACACCCCA
AATTTGGCAAATCTGCACTCCTCAAATGTTCTCATGTACAGTAGTACTGATGGTCAATACAAATGTGATGAATCAGATGTTGATACCTCTCTTCATCTCT
GA
AA sequence
>Lus10043166 pacid=23167918 polypeptide=Lus10043166 locus=Lus10043166.g ID=Lus10043166.BGIv1.0 annot-version=v1.0
MDRQSSTEPTIAKSSSIALLQERFRTLERAREMRRQRQLFRVFPEADHEKSDASSPSIYFRGSRLIVPDKPALIRDSSLQLQYPTMQPGQYAGFRVDDTP
NLANLHSSNVLMYSSTDGQYKCDESDVDTSLHL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10043166 0 1
AT2G28900 OEP16, ATOEP16-... outer envelope protein 16, OUT... Lus10040810 5.5 0.8131
AT2G28900 OEP16, ATOEP16-... outer envelope protein 16, OUT... Lus10016545 6.2 0.7967
AT5G64130 cAMP-regulated phosphoprotein ... Lus10028499 7.1 0.7072
AT2G23770 protein kinase family protein ... Lus10041323 17.5 0.6834
AT4G02340 alpha/beta-Hydrolases superfam... Lus10039814 19.2 0.7340
AT3G26300 CYP71B34 "cytochrome P450, family 71, s... Lus10035706 20.1 0.7213
AT3G26040 HXXXD-type acyl-transferase fa... Lus10042433 24.4 0.7652
AT1G24110 Peroxidase superfamily protein... Lus10004234 25.9 0.7384
AT4G28250 ATHEXPBETA1.6, ... expansin B3 (.1.2) Lus10039816 28.0 0.6862
AT1G24625 C2H2ZnF ZFP7 zinc finger protein 7 (.1) Lus10003681 28.6 0.7298

Lus10043166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.