Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55160 108 / 1e-32 ATSUMO2, SUMO2, SUM2 small ubiquitin-like modifier 2 (.1.2) AT4G26840 102 / 2e-30 ATSUMO1, SUMO1, SUM1 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1) AT5G48710 60 / 3e-13 Ubiquitin-like superfamily protein (.1) AT5G55856 51 / 3e-10 Ubiquitin-like superfamily protein (.1) AT5G55170 51 / 9e-10 ATSUMO3, SUMO3, SUM3 small ubiquitin-like modifier 3 (.1) AT2G32765 47 / 3e-08 ATSUMO5, SUM5 SUMO 5, small ubiquitinrelated modifier 5 (.1) AT5G48700 42 / 3e-06 Ubiquitin-like superfamily protein (.1) AT5G55855 40 / 3e-06 Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032561 [exp] 135 / 3e-43 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2) Lus10043185 [exp] 134 / 1e-42 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2) Lus10032560 [exp] 134 / 1e-42 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2) Lus10022539 [exp] 39 / 1e-05 AT5G55160 61 / 5e-14 small ubiquitin-like modifier 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G158300 [exp] 105 / 1e-31 AT5G55160 171 / 5e-57 small ubiquitin-like modifier 2 (.1.2) Potri.002G224800 [exp] 104 / 5e-31 AT5G55160 172 / 3e-57 small ubiquitin-like modifier 2 (.1.2) Potri.002G224700 [exp] 103 / 8e-31 AT4G26840 170 / 1e-56 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1) Potri.014G190300 [exp] 101 / 7e-30 AT5G55160 168 / 7e-56 small ubiquitin-like modifier 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF11976 [flax] [poplar] Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence Show only first row Show all	>Lus10043184 pacid=23168273 polypeptide=Lus10043184 locus=Lus10043184.g ID=Lus10043184.BGIv1.0 annot-version=v1.0 ATGTCAGGAGTAGTCAACCAGGAGGAAGAGAAGAAGCCGGCAGATCAGGGAGCTCACATCAACCTCAAGGTCAAGGGCCAGTCTGTTGACCTCAACGCCA TTGCATTCTTGTTTGATGGCCGCAGACTCCGCGCCGAGCAGACTCCGGACGAGCTAGAGATGGAGGATGGAGATGAAATAGATGCGATGCTCCATCAGAC GGGTGGTGGCGCGAGTGTCTAG
AA sequence Show only first row Show all	>Lus10043184 pacid=23168273 polypeptide=Lus10043184 locus=Lus10043184.g ID=Lus10043184.BGIv1.0 annot-version=v1.0 MSGVVNQEEEKKPADQGAHINLKVKGQSVDLNAIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGGASV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10043184 [exp]	0	1
AT5G43490			unknown protein		Lus10003153 [exp]	2.4	0.8289
AT5G56360		PSL4	PRIORITY IN SWEET LIFE 4, calm...		Lus10013398 [exp]	5.9	0.7983
AT3G02510			Regulator of chromosome conden...		Lus10017581 [exp]	6.6	0.8038
AT5G41020	MYB		myb family transcription facto...		Lus10024036 [exp]	7.6	0.8143
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10043185 [exp]	7.7	0.7989
AT3G05670			RING/U-box protein (.1)		Lus10031468 [exp]	8.5	0.7970
AT1G16210			unknown protein		Lus10022649 [exp]	9.9	0.8142
AT5G67320		HOS15	high expression of osmotically...		Lus10024972 [exp]	11.0	0.7921
AT3G05670			RING/U-box protein (.1)		Lus10015213 [exp]	12.4	0.8008
AT2G16920		UBC23 ,PFU2	PHO2 FAMILY UBIQUITIN CONJUGAT...		Lus10037778 [exp]	15.6	0.7461

Compare expression of checked genes

Lus10043184 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.