Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50720 170 / 8e-56 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) AT4G24960 166 / 5e-54 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3) AT2G42820 115 / 2e-33 HVA22F HVA22-like protein F (.1) AT1G74520 112 / 3e-32 ATHVA22A HVA22 homologue A (.1) AT5G62490 99 / 4e-27 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) AT1G69700 99 / 1e-26 ATHVA22C HVA22 homologue C (.1) AT4G36720 59 / 2e-11 HVA22K HVA22-like protein K (.1) AT1G75700 56 / 1e-10 HVA22G HVA22-like protein G (.1) AT1G19950 57 / 2e-10 HVA22H HVA22-like protein H (ATHVA22H) (.1) AT5G42560 56 / 9e-10 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032557 [exp] 259 / 1e-90 AT5G50720 172 / 8e-57 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Lus10023605 [exp] 120 / 5e-35 AT1G74520 246 / 7e-84 HVA22 homologue A (.1) Lus10024234 [exp] 120 / 6e-35 AT1G74520 244 / 5e-83 HVA22 homologue A (.1) Lus10031386 [exp] 111 / 6e-32 AT2G42820 246 / 4e-85 HVA22-like protein F (.1) Lus10042193 [exp] 116 / 5e-31 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1) Lus10010944 [exp] 109 / 5e-31 AT2G42820 246 / 7e-85 HVA22-like protein F (.1) Lus10037191 [exp] 107 / 7e-30 AT1G69700 231 / 6e-78 HVA22 homologue C (.1) Lus10008623 [exp] 96 / 1e-25 AT1G74520 234 / 5e-80 HVA22 homologue A (.1) Lus10033152 [exp] 61 / 8e-12 AT5G42560 328 / 7e-113 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G099700 [exp] 204 / 6e-69 AT5G50720 166 / 5e-54 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Potri.012G101600 [exp] 176 / 5e-58 AT5G50720 133 / 3e-41 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Potri.015G062800 [exp] 111 / 9e-32 AT1G74520 255 / 4e-88 HVA22 homologue A (.1) Potri.012G069300 [exp] 110 / 1e-31 AT1G74520 259 / 1e-89 HVA22 homologue A (.1) Potri.001G006000 [exp] 107 / 2e-30 AT2G42820 235 / 1e-80 HVA22-like protein F (.1) Potri.014G148600 [exp] 100 / 7e-28 AT5G62490 87 / 1e-22 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) Potri.005G152100 [exp] 69 / 2e-14 AT1G69700 102 / 1e-25 HVA22 homologue C (.1) Potri.001G283000 [exp] 66 / 2e-13 AT1G74520 98 / 1e-23 HVA22 homologue A (.1) Potri.017G139000 [exp] 66 / 3e-13 AT1G74520 119 / 5e-32 HVA22 homologue A (.1) Potri.007G029300 [exp] 63 / 1e-12 AT4G36720 252 / 2e-85 HVA22-like protein K (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [flax] [poplar] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Lus10043186 pacid=23168158 polypeptide=Lus10043186 locus=Lus10043186.g ID=Lus10043186.BGIv1.0 annot-version=v1.0 ATGAGCCGTTTCTGGACTTTCCTTACTCATGTTCACGCACTTGCTGGGCCAGTTGTGATGTTGCTGTATCCACTGTATGCATCGGTGATAGCAATAGAGA GTCCATCGAAAGATGACGACGAGCAGTGGCTGGCGTACTGGATTTTATACTCCTTCTTAACCCTATCGGAGATGCTCCTCCAGTCGATTCTGGAGTGGAT ACCAATTTGGTACACGTTGAAGCTGATGCTTGCGGCCTGGCTGGTGCTGCCGCAGTTCAGAGGGGCGGCTTTCATCTATGACCGATTTTTTAGGCAACAT ATCAGGAAGCATCTCACCCACAACAGTGCTGCTAATGGCTCCTCCAAGGCCACCAACAAGTTTGTTCACTTTGTTTCCCCCAAAAAAGTAAGCTCATTTT TCCAAACCTTGTCATTCTAA
AA sequence Show only first row Show all	>Lus10043186 pacid=23168158 polypeptide=Lus10043186 locus=Lus10043186.g ID=Lus10043186.BGIv1.0 annot-version=v1.0 MSRFWTFLTHVHALAGPVVMLLYPLYASVIAIESPSKDDDEQWLAYWILYSFLTLSEMLLQSILEWIPIWYTLKLMLAAWLVLPQFRGAAFIYDRFFRQH IRKHLTHNSAANGSSKATNKFVHFVSPKKVSSFFQTLSF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50720		ATHVA22E	ARABIDOPSIS THALIANA HVA22 HOM...		Lus10043186 [exp]	0	1
AT2G15730			P-loop containing nucleoside t...		Lus10021749 [exp]	4.2	0.8290
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10024648 [exp]	18.9	0.8137
					Lus10022643 [exp]	20.6	0.7990
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Lus10024770 [exp]	22.9	0.7991
AT5G14920			Gibberellin-regulated family p...		Lus10014519 [exp]	35.0	0.7779
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Lus10009782 [exp]	41.1	0.7909
AT4G14640		CAM8, AtCML8	calmodulin-like 8, calmodulin ...		Lus10004088 [exp]	44.5	0.7967
AT3G03773			HSP20-like chaperones superfam...		Lus10002623 [exp]	49.8	0.7941
AT5G53900			Serine/threonine-protein kinas...		Lus10041936 [exp]	52.0	0.7175
AT5G47450		ATTIP2;3, DELTA...	DELTA-TONOPLAST INTRINSIC PROT...		Lus10004733 [exp]	55.5	0.7915

Compare expression of checked genes

Lus10043186 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.