Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29670 100 / 2e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G47080 92 / 5e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G07280 90 / 2e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) AT5G20190 47 / 2e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G17940 43 / 5e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G04530 39 / 0.0002 TPR4 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040683 [exp] 119 / 5e-33 AT2G29670 474 / 5e-163 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10018221 [exp] 117 / 3e-32 AT2G29670 486 / 1e-167 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10005863 [exp] 84 / 2e-20 AT2G29670 462 / 6e-158 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10001206 [exp] 81 / 2e-19 AT1G07280 457 / 4e-156 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Lus10025981 [exp] 57 / 1e-10 AT2G29670 146 / 8e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014468 [exp] 48 / 1e-07 AT1G04530 177 / 1e-51 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10023721 [exp] 48 / 1e-07 AT1G04530 171 / 4e-49 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10002166 [exp] 46 / 6e-07 AT5G20190 192 / 8e-60 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10000257 [exp] 46 / 7e-07 AT1G04530 179 / 3e-52 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G044200 [exp] 103 / 4e-27 AT2G29670 484 / 5e-166 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G250100 [exp] 96 / 1e-24 AT2G29670 499 / 5e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G191600 [exp] 73 / 2e-16 AT2G29670 328 / 3e-106 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G130100 [exp] 49 / 7e-08 AT5G20190 180 / 5e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G065400 [exp] 45 / 9e-07 AT1G04530 160 / 5e-46 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G140500 [exp] 45 / 1e-06 AT4G17940 196 / 9e-62 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G068200 [exp] 44 / 2e-06 AT5G20190 167 / 6e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.008G172200 [exp] 44 / 3e-06 AT1G04530 137 / 1e-36 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G256900 [exp] 43 / 5e-06 AT4G17940 125 / 2e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G130300 [exp] 43 / 6e-06 AT5G20190 166 / 2e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043203 pacid=23168356 polypeptide=Lus10043203 locus=Lus10043203.g ID=Lus10043203.BGIv1.0 annot-version=v1.0 ATGCGGATCCATTTACCCAACCCATTAAATAAACTTAGCTATCCAATCCCTACTCTAAGAAAATCCTTCCCTAATTTTGGCAGGGTGGATGAATACTACA AGAGGCCAATCGGAACGGAGCCGGCGGATGCAGAGACGTTCAACAAATACGCAAACTTCCTGTGGAAAGTGAGAGACGATTTGTGGGCGGCGGAGGAGAC ATTTTTGGAAGCCATTGCGGCTGATCCGACGAACACATTCTACGCTGCTAATTACACGAGCTTTTTTGTGGACGATCGGCGGTGA
AA sequence Show only first row Show all	>Lus10043203 pacid=23168356 polypeptide=Lus10043203 locus=Lus10043203.g ID=Lus10043203.BGIv1.0 annot-version=v1.0 MRIHLPNPLNKLSYPIPTLRKSFPNFGRVDEYYKRPIGTEPADAETFNKYANFLWKVRDDLWAAEETFLEAIAADPTNTFYAANYTSFFVDDRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G29670			Tetratricopeptide repeat (TPR)...		Lus10043203 [exp]	0	1
AT2G14830			Regulator of Vps4 activity in ...		Lus10039808 [exp]	3.0	0.8216
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Lus10032299 [exp]	4.4	0.8401
AT3G06080		TBL10	TRICHOME BIREFRINGENCE-LIKE 10...		Lus10034039 [exp]	5.1	0.6891
					Lus10002237 [exp]	6.6	0.8385
AT1G68630			PLAC8 family protein (.1)		Lus10009036 [exp]	11.8	0.8195
AT1G64870			unknown protein		Lus10041678 [exp]	11.8	0.8149
AT1G76340		GONST3	golgi nucleotide sugar transpo...		Lus10034674 [exp]	16.6	0.6435
					Lus10010306 [exp]	17.3	0.7918
AT1G70850		MLP34	MLP-like protein 34 (.1.2.3)		Lus10002644 [exp]	20.9	0.7986
AT3G18150			RNI-like superfamily protein (...		Lus10029586 [exp]	22.5	0.7013

Compare expression of checked genes

Lus10043203 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.