Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17240 50 / 6e-09 unknown protein AT3G24506 49 / 2e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G079700 [exp] 52 / 3e-09 AT3G24506 96 / 5e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043214 pacid=23168080 polypeptide=Lus10043214 locus=Lus10043214.g ID=Lus10043214.BGIv1.0 annot-version=v1.0 ATGTCATCCTTCTGTCTCACCACCGTAGCTGGTCTTCCACCGGCAGCTAGAAAGGGATTTCATTCTGCTATTGCTTCAGTCGGCGTCCCCAGTGGTAGGG GAAGATTCCAAGTGGTTCGTATGGCTCGGACTCCCGACGAATTTCGATTCAATAACCCCAATCCCTATGATAGGCCTCTCGAATGGAAAAAGCCTAGGCC TGCGAAGAGACCGGACATATTTCACCAATTCAGGCCTGCGAGCACACCAATGCCGTCGCCGCTGCCATTTGATCCTCCCCTAGAATATTTCGACTTAGAA GAAGAAGAACAAGGCGGGCGTTATGGAAAATCAAAGTGA
AA sequence Show only first row Show all	>Lus10043214 pacid=23168080 polypeptide=Lus10043214 locus=Lus10043214.g ID=Lus10043214.BGIv1.0 annot-version=v1.0 MSSFCLTTVAGLPPAARKGFHSAIASVGVPSGRGRFQVVRMARTPDEFRFNNPNPYDRPLEWKKPRPAKRPDIFHQFRPASTPMPSPLPFDPPLEYFDLE EEEQGGRYGKSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G17240			unknown protein		Lus10043214 [exp]	0	1
AT1G01940			Cyclophilin-like peptidyl-prol...		Lus10009237 [exp]	4.7	0.7927
AT4G28706			pfkB-like carbohydrate kinase ...		Lus10011270 [exp]	7.6	0.7853
AT3G54900		ATGRXCP, CXIP1	GLUTAREDOXIN, CAX interacting ...		Lus10012592 [exp]	8.9	0.7207
AT1G08500		AtENODL18	early nodulin-like protein 18 ...		Lus10009231 [exp]	10.2	0.7212
AT4G30580		LPAT1, ATS2, EM...	lysophosphatidic acid acyltran...		Lus10036259 [exp]	10.2	0.7300
AT5G62950			RNA polymerase II, Rpb4, core ...		Lus10005329 [exp]	11.2	0.7195
AT1G65650		UCH2	Peptidase C12, ubiquitin carbo...		Lus10042047 [exp]	13.2	0.7803
AT1G19250		FMO1	flavin-dependent monooxygenase...		Lus10030750 [exp]	17.0	0.7248
AT5G52200		AtI-2	inhibitor-2, phosphoprotein ph...		Lus10005751 [exp]	17.7	0.7607
AT1G08780		PFD4, PDF4, AIP...	PREFOLDIN 4, ABI3-interacting ...		Lus10021994 [exp]	20.7	0.7624

Compare expression of checked genes

Lus10043214 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.