Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55980 40 / 2e-05 serine-rich protein-related (.1) AT3G13227 38 / 0.0001 serine-rich protein-related (.1) AT1G67910 37 / 0.0002 unknown protein AT5G20370 38 / 0.0003 serine-rich protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011094 [exp] 44 / 4e-07 AT5G55980 44 / 1e-06 serine-rich protein-related (.1) Lus10034901 [exp] 40 / 2e-05 AT1G67910 49 / 6e-09 unknown protein Lus10023632 [exp] 39 / 3e-05 AT1G67910 48 / 1e-08 unknown protein Lus10008880 [exp] 39 / 0.0001 AT5G55980 63 / 1e-13 serine-rich protein-related (.1) Lus10023227 [exp] 39 / 0.0001 AT5G55980 69 / 3e-16 serine-rich protein-related (.1) Lus10000442 [exp] 37 / 0.0002 AT1G67910 56 / 1e-11 unknown protein Lus10026701 [exp] 37 / 0.0002 AT1G67910 56 / 5e-12 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G079200 [exp] 40 / 8e-06 AT1G67910 45 / 9e-08 unknown protein Potri.001G371400 [exp] 40 / 6e-05 AT5G55980 50 / 2e-08 serine-rich protein-related (.1) Potri.010G046700 [exp] 37 / 0.0002 AT1G67910 82 / 4e-22 unknown protein Potri.008G186200 [exp] 37 / 0.0002 AT1G67910 85 / 4e-23 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043215 pacid=23168170 polypeptide=Lus10043215 locus=Lus10043215.g ID=Lus10043215.BGIv1.0 annot-version=v1.0 ATGGGATCCAACGCCGGCGATGGAAGCGGCACTGCCGCGGCAGGAGGTGGTGGTCAGTGCTTGTGCTCGCCAACGACGCATATGGGATCGTTCAGGTGCA GATTCCATGGAGCTTCTTCATCTGCTTTGAGTAAGAAGATGATGAAGAGATCATATTCCATGCCTGCTACTAACAATTCTTCTTCTTCTTCTTCTTCTTC TATTGCTCCTAATTCTACCTCGCCCTCTTTGGCTTGTAGTTATCCCAAGTCGGTTGAATCCACCTAA
AA sequence Show only first row Show all	>Lus10043215 pacid=23168170 polypeptide=Lus10043215 locus=Lus10043215.g ID=Lus10043215.BGIv1.0 annot-version=v1.0 MGSNAGDGSGTAAAGGGGQCLCSPTTHMGSFRCRFHGASSSALSKKMMKRSYSMPATNNSSSSSSSSIAPNSTSPSLACSYPKSVEST

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55980			serine-rich protein-related (....		Lus10043215 [exp]	0	1
AT1G09310			Protein of unknown function, D...		Lus10018630 [exp]	4.9	0.7999
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10032215 [exp]	5.5	0.7515
AT5G43850		ATARD4	RmlC-like cupins superfamily p...		Lus10021902 [exp]	6.5	0.8183
AT5G58770			Undecaprenyl pyrophosphate syn...		Lus10038313 [exp]	9.8	0.8164
AT1G04770			Tetratricopeptide repeat (TPR)...		Lus10011738 [exp]	12.1	0.7409
AT3G25180		CYP82G1	cytochrome P450, family 82, su...		Lus10038203 [exp]	12.6	0.7984
AT4G32480			Protein of unknown function (D...		Lus10041046 [exp]	14.5	0.8159
AT5G51010			Rubredoxin-like superfamily pr...		Lus10022430 [exp]	22.2	0.7488
AT2G39210			Major facilitator superfamily ...		Lus10014640 [exp]	25.1	0.7442
AT1G23200			Plant invertase/pectin methyle...		Lus10009110 [exp]	26.2	0.7441

Compare expression of checked genes

Lus10043215 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.