Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52342 48 / 6e-09 unknown protein AT3G13227 44 / 4e-07 serine-rich protein-related (.1) AT1G67910 41 / 4e-06 unknown protein AT5G20370 41 / 1e-05 serine-rich protein-related (.1) AT5G55980 40 / 1e-05 serine-rich protein-related (.1) AT1G24577 39 / 2e-05 unknown protein AT3G56500 37 / 0.0001 serine-rich protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023630 [exp] 74 / 5e-19 AT1G67910 44 / 2e-07 unknown protein Lus10008811 [exp] 41 / 5e-06 AT5G11090 61 / 2e-12 serine-rich protein-related (.1) Lus10023632 [exp] 40 / 1e-05 AT1G67910 48 / 1e-08 unknown protein Lus10034901 [exp] 40 / 1e-05 AT1G67910 49 / 6e-09 unknown protein Lus10039998 [exp] 40 / 3e-05 AT5G25280 157 / 3e-48 serine-rich protein-related (.1.2) Lus10001946 [exp] 40 / 4e-05 AT5G11090 179 / 9e-57 serine-rich protein-related (.1) Lus10008808 [exp] 40 / 4e-05 AT5G25280 153 / 2e-46 serine-rich protein-related (.1.2) Lus10038101 [exp] 39 / 4e-05 AT5G11090 54 / 2e-09 serine-rich protein-related (.1) Lus10001928 [exp] 39 / 5e-05 AT5G11090 177 / 3e-56 serine-rich protein-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G078900 [exp] 53 / 5e-11 AT3G13227 42 / 3e-06 serine-rich protein-related (.1) Potri.006G159300 [exp] 52 / 2e-10 AT1G24577 43 / 5e-07 unknown protein Potri.006G060700 [exp] 40 / 8e-06 AT5G11090 66 / 4e-14 serine-rich protein-related (.1) Potri.008G186200 [exp] 39 / 2e-05 AT1G67910 85 / 4e-23 unknown protein Potri.018G120300 [exp] 39 / 2e-05 AT5G11090 67 / 1e-14 serine-rich protein-related (.1) Potri.002G250700 [exp] 39 / 5e-05 AT3G56500 43 / 5e-06 serine-rich protein-related (.1) Potri.010G046700 [exp] 38 / 5e-05 AT1G67910 82 / 4e-22 unknown protein Potri.018G120400 [exp] 39 / 6e-05 AT5G11090 126 / 3e-36 serine-rich protein-related (.1) Potri.006G060800 [exp] 39 / 0.0001 AT5G25280 130 / 2e-37 serine-rich protein-related (.1.2) Potri.001G371400 [exp] 37 / 0.0002 AT5G55980 50 / 2e-08 serine-rich protein-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043217 pacid=23168357 polypeptide=Lus10043217 locus=Lus10043217.g ID=Lus10043217.BGIv1.0 annot-version=v1.0 ATGTGTCAGAAAATACTTGTTCTTCCACCGATGATGATGATCCCTCATCATCTCCGGTGGGTGGTTGTGCAGGGGATTGATGATGCAGGGGAAGCAGGGA GAGTGAGGACGTGTGTGTGTTCGCCGTCGAGGCATCCGGGATCATTCAGGTGTAGATACCATAGAGCTCAATATGAATGGAGGGTTTCCAGATCAATTTC TACTGCAGCAAGAATATGA
AA sequence Show only first row Show all	>Lus10043217 pacid=23168357 polypeptide=Lus10043217 locus=Lus10043217.g ID=Lus10043217.BGIv1.0 annot-version=v1.0 MCQKILVLPPMMMIPHHLRWVVVQGIDDAGEAGRVRTCVCSPSRHPGSFRCRYHRAQYEWRVSRSISTAARI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52342			unknown protein		Lus10043217 [exp]	0	1
AT3G23880			F-box and associated interacti...		Lus10027780 [exp]	2.2	0.8258
AT2G15680		AtCML30	calmodulin-like 30, Calcium-bi...		Lus10019863 [exp]	3.6	0.8665
AT1G80520			Sterile alpha motif (SAM) doma...		Lus10024059 [exp]	4.0	0.8279
AT1G77290			Glutathione S-transferase fami...		Lus10042756 [exp]	5.3	0.8393
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Lus10001711 [exp]	7.4	0.7939
AT5G08350			GRAM domain-containing protein...		Lus10010166 [exp]	11.0	0.8047
AT1G26920			unknown protein		Lus10012840 [exp]	12.4	0.7655
AT4G17370			Oxidoreductase family protein ...		Lus10028967 [exp]	12.8	0.7540
AT5G05180			unknown protein		Lus10029012 [exp]	18.5	0.8078
AT4G10310		ATHKT1, HKT1	high-affinity K+ transporter 1...		Lus10026948 [exp]	18.9	0.7685

Compare expression of checked genes

Lus10043217 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.