Lus10043232 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28850 241 / 3e-78 ATXTH26, XTH26, XTR18 xyloglucan endotransglucosylase/hydrolase 26 (.1)
AT4G25810 197 / 3e-61 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT3G23730 186 / 4e-57 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G37800 185 / 1e-56 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT5G57550 184 / 1e-56 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G30270 184 / 2e-56 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57560 183 / 4e-56 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT5G57530 181 / 3e-55 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G65730 179 / 2e-54 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT4G14130 179 / 3e-54 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011112 461 / 4e-165 AT4G28850 365 / 1e-127 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Lus10012978 345 / 3e-119 AT4G28850 359 / 3e-125 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Lus10034957 231 / 1e-75 AT4G28850 160 / 3e-48 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Lus10010938 199 / 3e-62 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031393 197 / 1e-61 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 197 / 2e-61 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031392 196 / 7e-61 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 189 / 3e-58 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10003048 187 / 2e-57 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G160700 348 / 1e-120 AT4G28850 390 / 9e-138 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Potri.018G084300 347 / 6e-120 AT4G28850 403 / 1e-142 xyloglucan endotransglucosylase/hydrolase 26 (.1)
Potri.002G060500 206 / 5e-65 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.018G095100 204 / 6e-64 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.005G201200 204 / 7e-64 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 202 / 2e-63 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 201 / 5e-63 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.018G095200 199 / 2e-62 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G094900 198 / 9e-62 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.009G083800 198 / 1e-61 AT2G14620 454 / 1e-162 xyloglucan endotransglucosylase/hydrolase 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10043232 pacid=23168014 polypeptide=Lus10043232 locus=Lus10043232.g ID=Lus10043232.BGIv1.0 annot-version=v1.0
ATGGCAACTCTTGGTTACTCCTCCTCCACTGTGTTTGTGGTGTTGGCATTCTCTGCATTTTCGATAATAGCATTCCATCCCACCTCCGTGGATGCTAAGT
TCTCCAAAAGTGTCTACTTCTACTGGGGTGCTCACCACTCTTCTATCCTTGGCAATGGGGATGACCTCCAGCTTGTGTTGGATCAATCCTCTGGGTCCGG
GATTAAGTCCAAGCGGCCCTTCTTGTTTGGCACCATTGAGATGCTAATCAAGTTGGTGCCTGGCAACTCTGCAGGAACAGTCACTGCATATTATGTGAGT
AAATATGAAAAAAGATCCTCATCTCAAACACCTGAATCCCCCTTCCAATTTGTAGTCCCCCCCCCCCCTCTCTCTCTCTCCTACATTACTATTCCTGAAC
TACGTCCTATTTCTGGCCTTCCAAGTGTCCGTCCGTGGGGTGTGCTGGATTCGAACCCGGAACCTCTAAACCGCCAATACACATGTGCAATAACACATTG
TCATGTTACCTTGTTGAGTTTTGAGAAAAGAGACATTGTTATTTGTCATAAGTGGTATGTGGATAGCGTGCCAATCAGAGTGTACCGCAACTACGAGAGC
CGAGGGGTGCCATACCCAAATAAGCAAGGGATGAGGGTCTACTCTAGCCTCTGGAACGCTGATAACTGGGCTACTAGAGGCGGGTTGGATAAGATCGATT
GGAATTCCGCACCCTTCGTAGCGAGATACCGCAATTTCAGGGCGAGGGCTTGCAAGTATGATGGACCTGCAAGCATCAACCAATGTACTGCAACTACTCC
AGCCAACTGGTGGACATCTGCTACACACAAACAGCTGAGCTTTCCCAAACAAGGACAGATGAAATGGGTGAGGGACAAGTACATGATCTATGACTACTGC
AAAGATGTCAAGAGGTTCAACGGCAATATCCCAGCTGAATGCTTCAACCCACAATTCTAA
AA sequence
>Lus10043232 pacid=23168014 polypeptide=Lus10043232 locus=Lus10043232.g ID=Lus10043232.BGIv1.0 annot-version=v1.0
MATLGYSSSTVFVVLAFSAFSIIAFHPTSVDAKFSKSVYFYWGAHHSSILGNGDDLQLVLDQSSGSGIKSKRPFLFGTIEMLIKLVPGNSAGTVTAYYVS
KYEKRSSSQTPESPFQFVVPPPPLSLSYITIPELRPISGLPSVRPWGVLDSNPEPLNRQYTCAITHCHVTLLSFEKRDIVICHKWYVDSVPIRVYRNYES
RGVPYPNKQGMRVYSSLWNADNWATRGGLDKIDWNSAPFVARYRNFRARACKYDGPASINQCTATTPANWWTSATHKQLSFPKQGQMKWVRDKYMIYDYC
KDVKRFNGNIPAECFNPQF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28850 ATXTH26, XTH26,... xyloglucan endotransglucosylas... Lus10043232 0 1
AT4G28850 ATXTH26, XTH26,... xyloglucan endotransglucosylas... Lus10011112 1.4 0.9074
AT5G05500 MOP10 Pollen Ole e 1 allergen and ex... Lus10040948 5.1 0.8931
AT3G10710 RHS12 root hair specific 12 (.1) Lus10033399 6.2 0.8883
AT1G30870 Peroxidase superfamily protein... Lus10038393 6.6 0.8719
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10025762 7.7 0.8048
AT5G22410 RHS18 root hair specific 18 (.1) Lus10004859 8.7 0.8706
AT3G10710 RHS12 root hair specific 12 (.1) Lus10034859 8.9 0.7368
AT1G12560 ATHEXPALPHA1.26... expansin A7 (.1) Lus10024478 9.4 0.8294
AT5G05500 MOP10 Pollen Ole e 1 allergen and ex... Lus10009837 10.4 0.8446
AT4G02270 RHS13 root hair specific 13 (.1) Lus10041926 10.9 0.8344

Lus10043232 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.