Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043213 [exp] 40 / 3e-05 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043242 pacid=23168399 polypeptide=Lus10043242 locus=Lus10043242.g ID=Lus10043242.BGIv1.0 annot-version=v1.0 ATGGCTTCCAAAGCTGCAACTTTCTTCTTCTTTTTGCTGGTGGCATCTTTGCTCATTACTGCTTCTTTTGGAGCTCGTCCGGATATTGTCGAAAAATCTG CCACCGGAAATCTGCAGGTGAGTGATGTTAGCTCCGCACCATCTCCTCCAGTTTCAGACGTTAATGATGAAATCGACTGTAATGGTGAAGGAGGCAAAAA AACCAAAAAGAAGAAAAAGAAGAACAGTCCTGGAGCAGACGGTCCTGCTGTGTATCCGGTGACCTTCCGGCGATACGTACTTGTCTCAGTTTCCCGGCAT CCGTTTGAAGTGCCAATATAA
AA sequence Show only first row Show all	>Lus10043242 pacid=23168399 polypeptide=Lus10043242 locus=Lus10043242.g ID=Lus10043242.BGIv1.0 annot-version=v1.0 MASKAATFFFFLLVASLLITASFGARPDIVEKSATGNLQVSDVSSAPSPPVSDVNDEIDCNGEGGKKTKKKKKKNSPGADGPAVYPVTFRRYVLVSVSRH PFEVPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10043242 [exp]	0	1
AT5G62040		BFT	brother of FT and TFL1, PEBP (...		Lus10027442 [exp]	6.3	0.7933
AT3G59010		PME61, PME35	pectin methylesterase 61 (.1)		Lus10026729 [exp]	8.5	0.7895
AT5G17860		CAX7	calcium exchanger 7 (.1)		Lus10001330 [exp]	14.9	0.7701
AT3G47570			Leucine-rich repeat protein ki...		Lus10040186 [exp]	19.3	0.7874
AT4G00050	bHLH	bHLH016, UNE10	unfertilized embryo sac 10, ba...		Lus10042875 [exp]	21.2	0.7845
AT5G25840			Protein of unknown function (D...		Lus10011427 [exp]	21.8	0.7660
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Lus10003897 [exp]	24.2	0.7075
AT1G65480		FT	FLOWERING LOCUS T, PEBP (phosp...		Lus10013532 [exp]	26.3	0.7789
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10009583 [exp]	41.0	0.7491
AT2G16460			Protein of unknown function (D...		Lus10041812 [exp]	42.5	0.7557

Compare expression of checked genes

Lus10043242 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.