Lus10043246 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043436 85 / 5e-21 ND /
Lus10014730 53 / 1e-09 AT3G24490 49 / 4e-08 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Lus10019388 53 / 1e-08 AT3G24490 200 / 2e-60 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Lus10019568 49 / 2e-08 AT3G24490 50 / 8e-09 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Lus10017725 42 / 4e-05 AT3G24490 243 / 1e-77 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10043246 pacid=23167912 polypeptide=Lus10043246 locus=Lus10043246.g ID=Lus10043246.BGIv1.0 annot-version=v1.0
ATGGACGACACCGATGATGATGACAGCTACCCACTCAAATCTTACACACCGAGCCACCGCACTACGAAGAAGAACAAATCTGCTTCACAGTCCTCCCACC
GTCCCCTTCCCAGGTTCTACAACCACCGTTACGATGACGTCCAAAACAATGAAGAAGATGACGATGCCAACGACGATTTCCTGTGGTACTCAAAGAGGAT
TAAGCAGCTCAAGAAGTCATCGGCTTCCAATTATGAATTCGCGGGATTGGAGTTGCAGAGCAAGCAAATGTTGGAGATAGCTCTGGCCGAGATTGCTAAA
ATCAGAGATGAGGATGAGGATGATGATGATGATGGTAATGACCCTGAAAGCAATGTCAATAAAGAAAGAAAAGCTGAGGATGAGAGTGGTGATGATGATG
ATTCTGGGGGGAATGTCAGCTAA
AA sequence
>Lus10043246 pacid=23167912 polypeptide=Lus10043246 locus=Lus10043246.g ID=Lus10043246.BGIv1.0 annot-version=v1.0
MDDTDDDDSYPLKSYTPSHRTTKKNKSASQSSHRPLPRFYNHRYDDVQNNEEDDDANDDFLWYSKRIKQLKKSSASNYEFAGLELQSKQMLEIALAEIAK
IRDEDEDDDDDGNDPESNVNKERKAEDESGDDDDSGGNVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10043246 0 1
AT1G04190 TPR3 tetratricopeptide repeat 3, Te... Lus10021905 56.1 0.6818
AT4G36420 Ribosomal protein L12 family p... Lus10028336 56.6 0.6657
AT2G44680 CKB4 casein kinase II beta subunit... Lus10042861 74.4 0.6674
AT1G52620 Pentatricopeptide repeat (PPR)... Lus10036090 76.2 0.6723
AT2G19480 NFA2, NFA02, NA... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10027615 95.9 0.6608
AT2G44680 CKB4 casein kinase II beta subunit... Lus10042859 166.3 0.6375
AT5G58030 Transport protein particle (TR... Lus10036292 168.3 0.6309
AT5G06810 Mitochondrial transcription te... Lus10012021 171.7 0.6373

Lus10043246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.