Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037746 [exp] 77 / 1e-19 ND / Lus10033157 [exp] 68 / 9e-16 ND / Lus10033001 [exp] 66 / 2e-15 ND / Lus10006296 [exp] 54 / 1e-10 ND / Lus10040622 [exp] 51 / 3e-09 AT1G31300 336 / 4e-116 TRAM, LAG1 and CLN8 (TLC) lipid-sensing domain containing protein (.1), TRAM, LAG1 and CLN8 (TLC) lipid-sensing domain containing protein (.2) Lus10036784 [exp] 38 / 0.0001 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043259 pacid=23168342 polypeptide=Lus10043259 locus=Lus10043259.g ID=Lus10043259.BGIv1.0 annot-version=v1.0 ATGAAGATTGGAGAGGCAGTTGTTGACCCCAACACAGATCGTAGGGTTAGACGTAGGAAGGAGCGAGCTGTAATGCAAGGAGTTGGGTTATACGCTAACC CTGACGAGGGAAACATGTACTTTAGGGGATCTACTTCAAGGATCGATGCAGAAGCAGAGCAAGTCATCAGACCATCTCAGCCACTACCGGGTACACAGCC AAGCGAGTGA
AA sequence Show only first row Show all	>Lus10043259 pacid=23168342 polypeptide=Lus10043259 locus=Lus10043259.g ID=Lus10043259.BGIv1.0 annot-version=v1.0 MKIGEAVVDPNTDRRVRRRKERAVMQGVGLYANPDEGNMYFRGSTSRIDAEAEQVIRPSQPLPGTQPSE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10043259 [exp]	0	1
AT4G31880			unknown protein		Lus10002307 [exp]	10.9	0.7190
AT1G24735			S-adenosyl-L-methionine-depend...		Lus10021804 [exp]	16.6	0.7068
AT5G45650			subtilase family protein (.1)		Lus10026062 [exp]	20.3	0.7036
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Lus10011662 [exp]	21.8	0.7030
AT3G10490	NAC	ANAC051, ANAC05...	Arabidopsis NAC domain contain...		Lus10014342 [exp]	22.0	0.5276
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006310 [exp]	22.5	0.7011
AT1G22370		ATUGT85A5	UDP-glucosyl transferase 85A5 ...		Lus10015747 [exp]	25.9	0.6952
					Lus10007927 [exp]	28.9	0.7011
					Lus10023587 [exp]	31.2	0.7011
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10024216 [exp]	33.3	0.7011

Compare expression of checked genes

Lus10043259 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.