Lus10043266 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20190 152 / 5e-45 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G80130 139 / 7e-40 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G32340 108 / 1e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G17940 101 / 1e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G04530 82 / 4e-18 TPR4 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G07280 77 / 5e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
AT2G29670 77 / 6e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019409 382 / 9e-136 AT5G20190 164 / 1e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002166 244 / 1e-80 AT5G20190 192 / 8e-60 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030103 240 / 5e-79 AT5G20190 179 / 1e-54 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002013 122 / 2e-33 AT4G32340 152 / 5e-45 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024949 105 / 5e-26 AT4G17940 125 / 8e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022877 101 / 5e-25 AT4G17940 121 / 5e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000257 102 / 1e-24 AT1G04530 179 / 3e-52 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014468 100 / 3e-24 AT1G04530 177 / 1e-51 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10023721 100 / 4e-24 AT1G04530 171 / 4e-49 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G130100 197 / 3e-62 AT5G20190 180 / 5e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G130300 191 / 1e-59 AT5G20190 166 / 2e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G068200 184 / 5e-57 AT5G20190 167 / 6e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G254300 124 / 2e-34 AT4G32340 157 / 2e-47 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G256900 105 / 4e-26 AT4G17940 125 / 2e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G140500 102 / 8e-26 AT4G17940 196 / 9e-62 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G172200 91 / 8e-21 AT1G04530 137 / 1e-36 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G065400 89 / 2e-20 AT1G04530 160 / 5e-46 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G250100 73 / 2e-14 AT2G29670 499 / 5e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G191600 71 / 5e-14 AT2G29670 328 / 3e-106 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10043266 pacid=23168270 polypeptide=Lus10043266 locus=Lus10043266.g ID=Lus10043266.BGIv1.0 annot-version=v1.0
ATGCTTCTACGAAGCTCATCAACTCCGATACTGAATTCATGGATCCCACACTCCAAAGATCAACATCAGTCACCGGAATCCGATTCCTTACCCCAAATTC
CGAGGACCCCATCCGTAACCTTGACCGCCTCATTTTCCAGCCCAATCTCGTCCCCTTCATCCTCTTCCCACGGTGATTACATCGGTAAAATGACGAGGGC
GCTTTCGGAGACGGATCTACGGAGTCTGTCATCATCAGCGCCGGTTCCGAAGAAGAATCCGAGGACCTTCGGGTTATCCGTCGAGGAGAAGGACGAGGAG
GAGGAGGAAACGGCGTCTTCCGATTGCGGGTTCGTTTGGGGATCCAACGGGTTGGGCGAAAAAACCGGATCGGAATGCGGCTTGTGGACGCTCGTGGCCG
GCGACGGAGCTGGCGGATGCGGCGGGAGGACAGGAACCGGCGGCCACGGTGGCGGGAGCGAGGAGTCTTCGGATTCGAATTATAAGACGGAGGTGTATTA
CGAGACAATGATCGAATCTAATCCTGGGAATTCGTTACTGATGGGGAACTACGCTAGGTTCTTGAAAGATGTTCGTGGGGATTTGGTGAAGGCGGAAGAG
TATTGCGGGAGAGCAATCCTGGTGAACCCTAACGACGGAGGTGTTCTTTCGATGTACGCCGATTTGATTTGGAGGAGCCACAAGGATTCTTCGAGAGCTG
AGAGCTATTTTGATCGCGCTGTTAAAGCCGCCCCTGAGGATTCGTAA
AA sequence
>Lus10043266 pacid=23168270 polypeptide=Lus10043266 locus=Lus10043266.g ID=Lus10043266.BGIv1.0 annot-version=v1.0
MLLRSSSTPILNSWIPHSKDQHQSPESDSLPQIPRTPSVTLTASFSSPISSPSSSSHGDYIGKMTRALSETDLRSLSSSAPVPKKNPRTFGLSVEEKDEE
EEETASSDCGFVWGSNGLGEKTGSECGLWTLVAGDGAGGCGGRTGTGGHGGGSEESSDSNYKTEVYYETMIESNPGNSLLMGNYARFLKDVRGDLVKAEE
YCGRAILVNPNDGGVLSMYADLIWRSHKDSSRAESYFDRAVKAAPEDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20190 Tetratricopeptide repeat (TPR)... Lus10043266 0 1
AT2G37250 ADK, ATPADK1 adenosine kinase (.1) Lus10001984 1.4 0.8420
AT5G20190 Tetratricopeptide repeat (TPR)... Lus10019409 2.0 0.8675
AT4G35790 ATPLDDELTA ARABIDOPSIS THALIANA PHOSPHOLI... Lus10004156 3.3 0.7556
AT2G34160 Alba DNA/RNA-binding protein (... Lus10021222 3.5 0.8052
AT5G41590 Protein of unknown function (D... Lus10017526 5.2 0.8264
AT5G47240 ATNUDT8 nudix hydrolase homolog 8 (.1) Lus10004371 7.1 0.7984
AT4G36470 S-adenosyl-L-methionine-depend... Lus10041380 10.5 0.7406
AT2G15220 Plant basic secretory protein ... Lus10014111 13.0 0.7339
AT3G06260 GolS9, GATL4 galactinol synthase 9, galactu... Lus10012765 13.9 0.7620
AT3G27110 Peptidase family M48 family pr... Lus10035210 17.3 0.7725

Lus10043266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.