Lus10043268 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20180 105 / 7e-31 Ribosomal protein L36 (.1.2)
ATCG00760 37 / 0.0001 ATCG00760.1, RPL36 ribosomal protein L36 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019412 166 / 1e-54 AT5G20180 114 / 2e-34 Ribosomal protein L36 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G131000 123 / 2e-37 AT5G20180 132 / 3e-41 Ribosomal protein L36 (.1.2)
Potri.006G069000 121 / 3e-37 AT5G20180 125 / 3e-39 Ribosomal protein L36 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00444 Ribosomal_L36 Ribosomal protein L36
Representative CDS sequence
>Lus10043268 pacid=23168167 polypeptide=Lus10043268 locus=Lus10043268.g ID=Lus10043268.BGIv1.0 annot-version=v1.0
ATGAAGGTTAGATCTTCAGTGAAGAAGATGTGCGAGTTCTGCCAAATAATTAAGAGGCGGGGAAGAATCTATGTGCTTTGCAGCTCCAATCCTAAGCACA
AGCAGCGACAGGGCATGTCCACCTTTGCCCAACAACAACAAAACATTATGATTCCACGCTTAGTGATGCTCATTAAAGTCATCTCCACTGTCTTTGCCAG
ATCTACAGAAACCAATATCGTTCGAGAGATCGCTCCTAACCATGGTGCAGGGATAGGTCTGCCTTCTCTGATACCTAAGAAGCATGAACCTTCAATTGTT
TTCGGATGGAGCGGGAGCCTTGCATCGCTCCTCTTCGGGCAAAGGAAGTAG
AA sequence
>Lus10043268 pacid=23168167 polypeptide=Lus10043268 locus=Lus10043268.g ID=Lus10043268.BGIv1.0 annot-version=v1.0
MKVRSSVKKMCEFCQIIKRRGRIYVLCSSNPKHKQRQGMSTFAQQQQNIMIPRLVMLIKVISTVFARSTETNIVREIAPNHGAGIGLPSLIPKKHEPSIV
FGWSGSLASLLFGQRK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20180 Ribosomal protein L36 (.1.2) Lus10043268 0 1
AT1G50660 unknown protein Lus10043111 23.1 0.6950
AT3G58660 Ribosomal protein L1p/L10e fam... Lus10024134 26.5 0.6801
AT2G18196 Heavy metal transport/detoxifi... Lus10010147 28.8 0.6941
AT5G52840 NADH-ubiquinone oxidoreductase... Lus10014951 49.5 0.6686
AT1G16740 Ribosomal protein L20 (.1) Lus10006327 52.6 0.6610
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10010993 56.1 0.6671
AT1G72020 unknown protein Lus10009443 62.1 0.6093
AT5G42630 GARP KAN4, KANADI4, ... KANADI 4, ABERRANT TESTA SHAPE... Lus10011660 108.5 0.6119
AT1G62830 ATLSD1, ATSWP1,... ARABIDOPSIS LYSINE-SPECIFIC HI... Lus10015996 114.4 0.5880
AT5G04820 OFP ATOFP13, OFP13 ARABIDOPSIS THALIANA OVATE FAM... Lus10016979 127.7 0.6009

Lus10043268 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.