Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41475 106 / 2e-30 Embryo-specific protein 3, (ATS3) (.1) AT5G62200 84 / 1e-21 Embryo-specific protein 3, (ATS3) (.1) AT5G62210 67 / 4e-15 Embryo-specific protein 3, (ATS3) (.1) AT5G07190 50 / 1e-08 ATS3 seed gene 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031684 [exp] 92 / 8e-25 AT5G62200 223 / 5e-75 Embryo-specific protein 3, (ATS3) (.1) Lus10027387 [exp] 92 / 1e-24 AT5G62200 225 / 1e-75 Embryo-specific protein 3, (ATS3) (.1) Lus10019416 [exp] 0 / 1 AT2G41475 179 / 7e-58 Embryo-specific protein 3, (ATS3) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G131800 [exp] 106 / 1e-30 AT2G41475 197 / 5e-65 Embryo-specific protein 3, (ATS3) (.1) Potri.006G069800 [exp] 102 / 7e-29 AT2G41475 194 / 1e-63 Embryo-specific protein 3, (ATS3) (.1) Potri.015G132700 [exp] 88 / 2e-23 AT5G62200 204 / 1e-67 Embryo-specific protein 3, (ATS3) (.1) Potri.001G193500 [exp] 86 / 1e-22 AT5G62200 184 / 1e-59 Embryo-specific protein 3, (ATS3) (.1) Potri.015G132900 [exp] 74 / 1e-17 AT5G62200 153 / 4e-47 Embryo-specific protein 3, (ATS3) (.1) Potri.012G130900 [exp] 74 / 1e-17 AT5G62200 154 / 1e-47 Embryo-specific protein 3, (ATS3) (.1) Potri.012G130800 [exp] 47 / 7e-08 AT5G62200 150 / 6e-47 Embryo-specific protein 3, (ATS3) (.1) Potri.010G214400 [exp] 45 / 5e-07 AT5G62200 93 / 7e-24 Embryo-specific protein 3, (ATS3) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0321 [flax] [poplar] PLAT PF06232 [flax] [poplar] ATS3 Embryo-specific protein 3, (ATS3)
Representative CDS sequence Show only first row Show all	>Lus10043273 pacid=23168159 polypeptide=Lus10043273 locus=Lus10043273.g ID=Lus10043273.BGIv1.0 annot-version=v1.0 ATGTTCCTACACAGTAACCATAAAGACCAGCTGCGCTTCACCTTCCTACACCAGAGACCAAATCAGACTTGCCTTTGGCGATTCATCAACGAGGTCTATG CCAAGAGGATTGACGACCCATATTCAAGGACATTCGAGAGGTGTTCCAAGGACACGTTCAAGATCACGGGACCCTGCGTTAGGAGCGTCTGCTATCTGTA CATGCTTAGGAAGGGATCCGACGGATGGAAACCAGAGAGTGTGAAGATCTACGGTCAGTATTTTGGAACTGTTGGCTTTTGA
AA sequence Show only first row Show all	>Lus10043273 pacid=23168159 polypeptide=Lus10043273 locus=Lus10043273.g ID=Lus10043273.BGIv1.0 annot-version=v1.0 MFLHSNHKDQLRFTFLHQRPNQTCLWRFINEVYAKRIDDPYSRTFERCSKDTFKITGPCVRSVCYLYMLRKGSDGWKPESVKIYGQYFGTVGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G41475			Embryo-specific protein 3, (AT...		Lus10043273 [exp]	0	1
AT2G44650		CHL-CPN10	chloroplast chaperonin 10 (.1)		Lus10043345 [exp]	1.7	0.8300
AT1G28150			unknown protein		Lus10030561 [exp]	2.4	0.8170
AT2G22170			Lipase/lipooxygenase, PLAT/LH2...		Lus10006497 [exp]	4.2	0.7788
AT5G46850			unknown protein		Lus10040093 [exp]	5.5	0.7169
AT1G31790			Tetratricopeptide repeat (TPR)...		Lus10035697 [exp]	6.9	0.7598
AT1G71890		SUC5, ATSUC5	SUCROSE-PROTON SYMPORTER 5, Ma...		Lus10003330 [exp]	7.1	0.7101
AT5G42450			Pentatricopeptide repeat (PPR)...		Lus10034408 [exp]	7.1	0.7468
AT3G29230			Tetratricopeptide repeat (TPR)...		Lus10027455 [exp]	10.2	0.7664
AT1G09680			Pentatricopeptide repeat (PPR)...		Lus10014170 [exp]	10.2	0.7747
AT1G05590		HEXO2, ATHEX3	BETA-HEXOSAMINIDASE 3, beta-he...		Lus10030348 [exp]	10.5	0.6969

Compare expression of checked genes

Lus10043273 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.