Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005758 [exp] 74 / 6e-17 AT3G61150 419 / 3e-137 HOMEODOMAIN-GLABRA2 1, homeodomain GLABROUS 1 (.1) Lus10027437 [exp] 47 / 2e-07 AT3G61150 715 / 0.0 HOMEODOMAIN-GLABRA2 1, homeodomain GLABROUS 1 (.1) Lus10027439 [exp] 45 / 2e-07 AT4G00730 122 / 2e-33 ANTHOCYANINLESS 2, ARABIDOPSIS THALIANA HOMEODOMAIN PROTEIN, Homeobox-leucine zipper family protein / lipid-binding START domain-containing protein (.1.2) Lus10011633 [exp] 46 / 3e-07 AT3G61150 160 / 2e-42 HOMEODOMAIN-GLABRA2 1, homeodomain GLABROUS 1 (.1) Lus10005759 [exp] 43 / 3e-06 AT3G61150 706 / 0.0 HOMEODOMAIN-GLABRA2 1, homeodomain GLABROUS 1 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043281 pacid=23168436 polypeptide=Lus10043281 locus=Lus10043281.g ID=Lus10043281.BGIv1.0 annot-version=v1.0 ATGGATGCTCCTGGAAACCATATCTCCCTCCGTGGTGTTAATCTTGATAATCTTATGTCTGAGGACGCCAACCAAATGGCCGTACTTCAGGAATCGTGGC ACGATGCTTCGGGACCACCGGTGAGTGTGACATTGATGGAGATGGTGATGAGCAGTGGAGAAAACATCTCTTGCCATCTGGGTATGCTATTCTCCCGGAT GGAACTTTCCTATGGCCACCATGGAAGGTGA
AA sequence Show only first row Show all	>Lus10043281 pacid=23168436 polypeptide=Lus10043281 locus=Lus10043281.g ID=Lus10043281.BGIv1.0 annot-version=v1.0 MDAPGNHISLRGVNLDNLMSEDANQMAVLQESWHDASGPPVSVTLMEMVMSSGENISCHLGMLFSRMELSYGHHGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10043281 [exp]	0	1
AT5G42230		SCPL41	serine carboxypeptidase-like 4...		Lus10023444 [exp]	8.3	0.8325
					Lus10000178 [exp]	9.8	0.7461
AT3G55700			UDP-Glycosyltransferase superf...		Lus10040244 [exp]	10.0	0.7418
AT2G36020		HVA22J	HVA22-like protein J (.1)		Lus10004215 [exp]	11.2	0.8037
AT2G48010		RKF3	receptor-like kinase in in flo...		Lus10008186 [exp]	11.5	0.7714
AT5G51280			DEAD-box protein abstrakt, put...		Lus10012900 [exp]	11.7	0.8256
AT1G33530			F-box family protein (.1)		Lus10014984 [exp]	14.8	0.8186
AT5G18960	FAR1_related	FRS12	FAR1-related sequence 12 (.1)		Lus10023137 [exp]	15.6	0.8015
AT3G29410		AtTPS25	Terpenoid cyclases/Protein pre...		Lus10038330 [exp]	17.0	0.8168
AT4G12570		UPL5	ubiquitin protein ligase 5 (.1...		Lus10039026 [exp]	20.4	0.8102

Compare expression of checked genes

Lus10043281 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.