Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55270 64 / 6e-14 Galactose oxidase/kelch repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019425 [exp] 123 / 2e-35 AT1G55270 652 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1) Lus10030072 [exp] 116 / 9e-35 AT1G55270 139 / 4e-39 Galactose oxidase/kelch repeat superfamily protein (.1) Lus10001071 [exp] 119 / 7e-34 AT1G55270 655 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G217700 [exp] 78 / 9e-19 AT1G55270 733 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1) Potri.001G008000 [exp] 69 / 1e-15 AT1G55270 731 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043282 pacid=23167943 polypeptide=Lus10043282 locus=Lus10043282.g ID=Lus10043282.BGIv1.0 annot-version=v1.0 ATGAGCATATCCATAGTTGATGTTTCGAAGTCCGAAGATCTCGGGGAAGCTCCTGCCGAGCATTTGTGGGAAACTCTCTCGGGGAGAGGGCAGTTCAAGA CTATAGTCTCGAATCTTTGGTCGAGCCTTGCTGGAAGGAACCGCCTGCGAAGTCACATTGTTCACTGCCAGGTTCTTCAAGCGTAA
AA sequence Show only first row Show all	>Lus10043282 pacid=23167943 polypeptide=Lus10043282 locus=Lus10043282.g ID=Lus10043282.BGIv1.0 annot-version=v1.0 MSISIVDVSKSEDLGEAPAEHLWETLSGRGQFKTIVSNLWSSLAGRNRLRSHIVHCQVLQA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55270			Galactose oxidase/kelch repeat...		Lus10043282 [exp]	0	1
AT3G14470			NB-ARC domain-containing disea...		Lus10000417 [exp]	3.7	0.7533
AT1G55270			Galactose oxidase/kelch repeat...		Lus10019425 [exp]	4.5	0.7616
AT1G14340			RNA-binding (RRM/RBD/RNP motif...		Lus10007254 [exp]	12.0	0.7381
AT1G74910			ADP-glucose pyrophosphorylase ...		Lus10032440 [exp]	22.4	0.7186
AT5G04850		VPS60.2	SNF7 family protein (.1.2)		Lus10008953 [exp]	22.4	0.7362
AT2G07180			Protein kinase superfamily pro...		Lus10040588 [exp]	24.2	0.7014
AT5G10530			Concanavalin A-like lectin pro...		Lus10033778 [exp]	26.6	0.7231
AT3G50830		ATCOR413-PM2, C...	cold-regulated 413-plasma memb...		Lus10023833 [exp]	29.0	0.7189
AT4G32300		SD2-5	S-domain-2 5 (.1)		Lus10034193 [exp]	33.5	0.6922
AT1G67856			RING/U-box superfamily protein...		Lus10011416 [exp]	34.0	0.7130

Compare expression of checked genes

Lus10043282 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.