Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14378 48 / 7e-08 Protein of unknown function (DUF1278) (.1) AT5G51105 47 / 2e-07 Protein of unknown function (DUF1278) (.1) AT4G35165 46 / 3e-07 Protein of unknown function (DUF1278) (.1) AT5G52965 41 / 2e-05 Protein of unknown function (DUF1278) (.1) AT5G52975 41 / 3e-05 Protein of unknown function (DUF1278) (.1) AT4G39340 39 / 0.0001 Protein of unknown function (DUF1278) (.1) AT3G48675 39 / 0.0001 Protein of unknown function (DUF1278) (.1) AT2G21740 39 / 0.0002 Protein of unknown function (DUF1278) (.1) AT2G21750 37 / 0.0009 Protein of unknown function (DUF1278) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019428 [exp] 182 / 1e-60 AT2G14378 50 / 1e-08 Protein of unknown function (DUF1278) (.1) Lus10019101 [exp] 139 / 9e-43 AT2G14378 50 / 3e-08 Protein of unknown function (DUF1278) (.1) Lus10028291 [exp] 138 / 1e-42 AT2G14378 44 / 8e-06 Protein of unknown function (DUF1278) (.1) Lus10034455 [exp] 134 / 3e-41 AT2G14378 49 / 5e-08 Protein of unknown function (DUF1278) (.1) Lus10032886 [exp] 79 / 1e-19 AT5G52975 52 / 1e-09 Protein of unknown function (DUF1278) (.1) Lus10019552 [exp] 77 / 6e-19 AT5G51105 37 / 7e-04 Protein of unknown function (DUF1278) (.1) Lus10027141 [exp] 75 / 4e-18 AT5G52975 46 / 5e-07 Protein of unknown function (DUF1278) (.1) Lus10001307 [exp] 74 / 1e-17 AT5G52975 44 / 2e-06 Protein of unknown function (DUF1278) (.1) Lus10019549 [exp] 71 / 2e-16 AT5G51105 49 / 4e-08 Protein of unknown function (DUF1278) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G306600 [exp] 37 / 0.0008 AT2G21740 112 / 7e-33 Protein of unknown function (DUF1278) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence Show only first row Show all	>Lus10043285 pacid=23168103 polypeptide=Lus10043285 locus=Lus10043285.g ID=Lus10043285.BGIv1.0 annot-version=v1.0 ATGCCGACCAACTCCGAGCGGCTGGAGCCGGAAGTGGCAGCGGGATGTTGGAAGGAGATATACCAAGTTCCCAGCTGCGTTTTCAACTTAATAAAGGCCT TCGTCGGCGGAGGGTCGATCGATGGCGTTGGTGTCCCCTGCTGCAAGGCTTTCCTTTCCCTCACCGGAGATTGCCAGGTTGAGATTTTCCAAAACAGTAC CATTACACCAGTCATTGAGGGTTTCTGCACTGCCATTGTCAGCTCTGGTGACTCGCCTCCCCTACCCCCGATCGCGCCTGCACCAGAAAGTGGTGGAGCA GCTCCGCCGGTGGCAGAGCCACCTACGGATGGTGTTAATGTTGCTGATTTTCCGTGGTCTACAGTTCGACTTGTTTAA
AA sequence Show only first row Show all	>Lus10043285 pacid=23168103 polypeptide=Lus10043285 locus=Lus10043285.g ID=Lus10043285.BGIv1.0 annot-version=v1.0 MPTNSERLEPEVAAGCWKEIYQVPSCVFNLIKAFVGGGSIDGVGVPCCKAFLSLTGDCQVEIFQNSTITPVIEGFCTAIVSSGDSPPLPPIAPAPESGGA APPVAEPPTDGVNVADFPWSTVRLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51105			Protein of unknown function (D...		Lus10043285 [exp]	0	1
AT1G21130		IGMT4	indole glucosinolate O-methylt...		Lus10030187 [exp]	1.0	0.9930
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10041829 [exp]	7.1	0.9215
AT5G09500			Ribosomal protein S19 family p...		Lus10026127 [exp]	8.1	0.8543
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10030174 [exp]	8.5	0.8198
					Lus10028570 [exp]	9.6	0.9648
AT2G29040			Exostosin family protein (.1)		Lus10016532 [exp]	10.3	0.9145
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10017677 [exp]	10.9	0.8820
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Lus10030693 [exp]	11.7	0.9648
AT2G15220			Plant basic secretory protein ...		Lus10001608 [exp]	13.6	0.9648
AT5G16690		ORC3, ATORC3	origin recognition complex sub...		Lus10021778 [exp]	13.9	0.8613

Compare expression of checked genes

Lus10043285 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.