Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25700 71 / 1e-16 ASK3 SKP1-like 3 (.1) AT4G34470 66 / 8e-15 ASK12 SKP1-like 12 (.1) AT1G75950 63 / 1e-13 UIP1, SKP1A, ATSKP1, ASK1, SKP1 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) AT4G34210 62 / 2e-13 ASK11 SKP1-like 11 (.1) AT1G20140 61 / 8e-13 ASK4 SKP1-like 4 (.1) AT5G42190 61 / 1e-12 SKP1B, ASK2 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) AT3G60010 60 / 2e-12 ASK13 SKP1-like 13 (.1) AT2G03170 59 / 3e-12 ASK14 SKP1-like 14 (.1) AT3G21830 58 / 8e-12 ASK8 SKP1-like 8 (.1) AT3G21850 57 / 3e-11 ASK9 SKP1-like 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019432 [exp] 120 / 3e-36 AT1G20140 186 / 2e-61 SKP1-like 4 (.1) Lus10017281 [exp] 69 / 6e-16 AT5G42190 259 / 4e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Lus10005610 [exp] 69 / 7e-16 AT5G42190 261 / 2e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Lus10017282 [exp] 69 / 7e-16 AT5G42190 259 / 6e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Lus10013575 [exp] 67 / 4e-15 AT1G75950 255 / 2e-88 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) Lus10041874 [exp] 66 / 9e-15 AT4G34210 201 / 3e-67 SKP1-like 11 (.1) Lus10019794 [exp] 66 / 1e-14 AT1G75950 241 / 8e-83 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) Lus10014115 [exp] 64 / 4e-13 AT1G68010 700 / 0.0 hydroxypyruvate reductase (.1.2) Lus10002803 [exp] 55 / 2e-10 AT1G20140 189 / 3e-62 SKP1-like 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G135800 [exp] 74 / 8e-18 AT1G20140 215 / 9e-73 SKP1-like 4 (.1) Potri.002G018700 [exp] 72 / 5e-17 AT5G42190 249 / 6e-86 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.005G243100 [exp] 69 / 5e-16 AT1G75950 244 / 2e-84 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) Potri.004G175900 [exp] 69 / 6e-16 AT5G42190 245 / 2e-84 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.005G109900 [exp] 67 / 5e-15 AT5G42190 249 / 5e-86 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.005G094800 [exp] 52 / 3e-09 AT3G21860 114 / 2e-32 SKP1-like 10 (.1) Potri.001G132300 [exp] 46 / 4e-07 AT1G75950 122 / 3e-36 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0033 [flax] [poplar] POZ PF03931 [flax] [poplar] Skp1_POZ Skp1 family, tetramerisation domain CL0033 [flax] [poplar] PF01466 [flax] [poplar] Skp1 Skp1 family, dimerisation domain
Representative CDS sequence Show only first row Show all	>Lus10043288 pacid=23167899 polypeptide=Lus10043288 locus=Lus10043288.g ID=Lus10043288.BGIv1.0 annot-version=v1.0 ATGTCGTTCACCCTGAAGAGCAGCGACGGTAAGTTGTTCCAAGTAGCTGAGGCGGTGGCAATGGAATCGCAGACAATCAAGAACTTAATCGAGGATGGTT GTGCTGACGATGAAATGCCCATCACCAACGTTACCGGCCATACATTGGGCCACGGTCTACGACGTTACAATGGCTGCCAACTATTTGAACATCATGGGGC TGTTGGATCTCGCATGCCAAAGGGAAAGACTCCACAGCAAATGAGGGACTATTTGGGCATCCAAAACGACTTATCTCCAGAGGAGCAGGAAAAAGATTCG CATGGAGAACCAGTGGGCATTTGA
AA sequence Show only first row Show all	>Lus10043288 pacid=23167899 polypeptide=Lus10043288 locus=Lus10043288.g ID=Lus10043288.BGIv1.0 annot-version=v1.0 MSFTLKSSDGKLFQVAEAVAMESQTIKNLIEDGCADDEMPITNVTGHTLGHGLRRYNGCQLFEHHGAVGSRMPKGKTPQQMRDYLGIQNDLSPEEQEKDS HGEPVGI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25700		ASK3	SKP1-like 3 (.1)		Lus10043288 [exp]	0	1
					Lus10024757 [exp]	1.0	0.9982
					Lus10040041 [exp]	1.4	0.9755
					Lus10017800 [exp]	3.2	0.9042
AT1G75980			Single hybrid motif superfamil...		Lus10017287 [exp]	3.5	0.9447
					Lus10014474 [exp]	3.5	0.9525
AT1G75290			NAD(P)-binding Rossmann-fold s...		Lus10021709 [exp]	6.5	0.8885
AT5G61120			unknown protein		Lus10030998 [exp]	7.7	0.8548
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10031726 [exp]	7.9	0.8709
AT5G08370		ATAGAL2	alpha-galactosidase 2 (.1.2)		Lus10038325 [exp]	11.8	0.8681
AT3G59250			F-box/RNI-like superfamily pro...		Lus10031018 [exp]	12.2	0.8086

Compare expression of checked genes

Lus10043288 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.