Plant FIBer expression Database

Lus10043290 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25940 76 / 5e-19 early nodulin-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019434
[exp]
172 / 3e-57 AT5G25940 75 / 8e-19 early nodulin-related (.1)
Lus10030052
[exp]
132 / 1e-41 AT5G25940 74 / 3e-18 early nodulin-related (.1)
Lus10033027
[exp]
127 / 1e-39 AT5G25940 69 / 2e-16 early nodulin-related (.1)
Lus10002236
[exp]
62 / 1e-13 AT5G25940 82 / 3e-21 early nodulin-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G184000
[exp]
130 / 8e-41 AT5G25940 74 / 4e-18 early nodulin-related (.1)
Potri.009G143800
[exp]
127 / 1e-39 AT5G25940 65 / 1e-14 early nodulin-related (.1)
Potri.019G033700
[exp]
79 / 5e-20 AT5G25940 68 / 1e-15 early nodulin-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03386 ENOD93 Early nodulin 93 ENOD93 protein
Representative CDS sequence
>Lus10043290 pacid=23167969 polypeptide=Lus10043290 locus=Lus10043290.g ID=Lus10043290.BGIv1.0 annot-version=v1.0
ATGACAAAGAATGTGGTTCAGTCTCCCTCTCTGGACACCAGCATGTCTTTCCATGACCAAAGGTTGGCCATGGCTAAGCAATGCTCTCATGAGGGTGTGG
TTGCTGGAGCAAAGGCAGCTGTGATTGCTGGCATAGCTACTGCTATCCCAACTATGGCTAGTGCAAGGATGCTTCCATGGGCAAAAGCTAATCTGAACTA
CACTGCTCAAGCTCTCATCATATCCACAGTTGCTGGAGCAGCCTATTTCATAGTTGCTGACAAAACTGTGCTGGCTACTGCAAGAAAGAACTCTTTCAAG
CACGCTGCTAACAACTGA
AA sequence
>Lus10043290 pacid=23167969 polypeptide=Lus10043290 locus=Lus10043290.g ID=Lus10043290.BGIv1.0 annot-version=v1.0
MTKNVVQSPSLDTSMSFHDQRLAMAKQCSHEGVVAGAKAAVIAGIATAIPTMASARMLPWAKANLNYTAQALIISTVAGAAYFIVADKTVLATARKNSFK
HAANN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25940 early nodulin-related (.1) Lus10043290
[exp]
0 1
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10023036
[exp]
3.6 0.7493
AT1G06340 Plant Tudor-like protein (.1) Lus10039027
[exp]
5.1 0.7493
AT5G36220 CYP91A1, CYP81D... CYTOCHROME P450 91A1, cytochro... Lus10018718
[exp]
6.2 0.7493
AT3G18570 Oleosin family protein (.1) Lus10032461
[exp]
7.0 0.7051
AT4G05200 CRK25 cysteine-rich RLK (RECEPTOR-li... Lus10026169
[exp]
7.2 0.7493
AT4G12910 SCPL20 serine carboxypeptidase-like 2... Lus10020207
[exp]
7.7 0.6303
AT2G44220 Protein of Unknown Function (D... Lus10006862
[exp]
8.1 0.7493
AT4G26466 LRE lorelei (.1) Lus10011066
[exp]
11.2 0.6809
AT5G28823 unknown protein Lus10040056
[exp]
11.4 0.6383
AT1G09330 ECHIDNA, ECH unknown protein Lus10010898
[exp]
11.7 0.7131

Lus10043290 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.