Lus10043293 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17486 242 / 4e-81 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 226 / 3e-74 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 207 / 1e-66 PPPDE putative thiol peptidase family protein (.1.2)
AT5G25170 194 / 3e-62 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 189 / 6e-60 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 191 / 1e-56 unknown protein
AT1G80690 174 / 2e-54 PPPDE putative thiol peptidase family protein (.1)
AT4G25680 76 / 4e-16 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 73 / 3e-15 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 66 / 1e-12 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019437 479 / 3e-174 AT4G17486 241 / 1e-80 PPPDE putative thiol peptidase family protein (.1.2)
Lus10013657 357 / 4e-126 AT4G17486 243 / 1e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10033030 336 / 2e-117 AT4G17486 225 / 3e-74 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040170 242 / 4e-81 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004755 230 / 2e-76 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
Lus10007844 229 / 7e-76 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004372 220 / 1e-68 AT5G47310 244 / 1e-77 PPPDE putative thiol peptidase family protein (.1)
Lus10003951 203 / 3e-65 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10032708 203 / 3e-65 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G070600 327 / 2e-114 AT4G17486 235 / 1e-78 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G154400 322 / 8e-113 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2)
Potri.001G154400 252 / 7e-85 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.003G080300 251 / 1e-84 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.002G134200 208 / 3e-67 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 206 / 2e-66 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.018G021700 204 / 5e-66 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.T126004 204 / 8e-66 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 203 / 2e-65 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G261500 203 / 2e-65 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10043293 pacid=23168340 polypeptide=Lus10043293 locus=Lus10043293.g ID=Lus10043293.BGIv1.0 annot-version=v1.0
ATGGCGGCTGCTTCAGAAGCGATCTTGGATCATTCCAGCTCCGAGAAGGAGAACTCCGACGAAAGCGCCGAAACTCTGGTCTTTTTAAACGTCTACGACC
TCACCTCTGTCAACAATTACACTTATTGGTTCGGCTTTGGGATTTTCCACTCCGGCATTGAAGTTCATGGTAAAGAGTATGGCTTTGGAGCTCATGATTT
CCCAATTAGCGGAGTGTTTGAAGTTGAGCCAAGAAACTGCCCAGGTTTCATTTACAGATGCTCCATCCCACTGGGGCGCATATCGATGCATCATAGTGAG
TTGAGGACATTCATAGAGAGCATGGCTTCCGAGTATCACGGTGACACGTACCACCTCATCTCCAAGAACTGCAACCATTTTACAGATGATGTCAGCTACA
GGTTGGTTGGAAAGAGCATACCGGGTTTCATAAATCGACTTGCCCGGCTTGGTGCTCTATGTAGTTGTTTGCTTCCCGAAAGCCTTCAAGTTACTGCAGT
GAAACAACTACCTGAACACCATGACTTTTTGGAAGAAGATGGAAGTGAGTCTATGACAACTGCCTCCCCGCCGCGTGGGTCTACAGAAATTGACGACAAG
GATGAAGATAGGCATCTGCTGTCACCAAGAAATGGAGCTGCTGGAGAAATCTCATTTGTGAAAGAGAGATGTGGGACGGAAAACAAGCCACCTCCATTTC
AAGAATTTGTGAGCAGAAGAAATGGGATAGAATAG
AA sequence
>Lus10043293 pacid=23168340 polypeptide=Lus10043293 locus=Lus10043293.g ID=Lus10043293.BGIv1.0 annot-version=v1.0
MAAASEAILDHSSSEKENSDESAETLVFLNVYDLTSVNNYTYWFGFGIFHSGIEVHGKEYGFGAHDFPISGVFEVEPRNCPGFIYRCSIPLGRISMHHSE
LRTFIESMASEYHGDTYHLISKNCNHFTDDVSYRLVGKSIPGFINRLARLGALCSCLLPESLQVTAVKQLPEHHDFLEEDGSESMTTASPPRGSTEIDDK
DEDRHLLSPRNGAAGEISFVKERCGTENKPPPFQEFVSRRNGIE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17486 PPPDE putative thiol peptidase... Lus10043293 0 1
AT3G14110 FLU FLUORESCENT IN BLUE LIGHT, Tet... Lus10037686 3.3 0.8156
AT4G17486 PPPDE putative thiol peptidase... Lus10019437 6.3 0.8252
AT4G14640 CAM8, AtCML8 calmodulin-like 8, calmodulin ... Lus10041179 6.5 0.8287
Lus10027917 7.3 0.8361
AT5G50175 unknown protein Lus10019469 7.3 0.8306
AT4G00620 EMB3127 EMBRYO DEFECTIVE 3127, Amino a... Lus10012502 8.5 0.7749
AT4G35160 O-methyltransferase family pro... Lus10001510 10.2 0.8031
AT1G75450 ATCKX6, ATCKX5,... CYTOKININ OXIDASE 6, ARABIDOPS... Lus10024289 10.9 0.7572
AT5G45550 MOB1-like MOB1-like, Mob1/phocein family... Lus10017172 11.0 0.8343
AT2G39370 MAKR4 MEMBRANE-ASSOCIATED KINASE REG... Lus10030311 13.0 0.7813

Lus10043293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.