Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019456 [exp] 161 / 6e-53 ND 37 / 0.002 Lus10038429 [exp] 134 / 3e-42 AT2G18370 44 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10038430 [exp] 72 / 1e-17 ND 37 / 7e-04 Lus10038428 [exp] 69 / 2e-16 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043307 pacid=23167920 polypeptide=Lus10043307 locus=Lus10043307.g ID=Lus10043307.BGIv1.0 annot-version=v1.0 ATGATTTGCCTAAGCAGCAGCAGCATCAACTTTGGTGAAGCAGCCAGACTGCCGACCGACGATTCCTCAAATTGTGTTACTTACCAAAGCAAAGTCCCTG ACTGCGTCACCTATTTGGGTAGTAAGGACACCGACACCCCGCCTCAGAGCTGCTGCACACAGCTTAAGAAACTACTAGCCCCACCAGCGGACCAACTCAA GCCGGTCTGCGCTTGCATGAAACCGGTTTTTGCGAGCAATCCTAAGGCCGGTACTATTGTCACGGGGTGCAATGCTCAGAATGAGGTCGCTAAGTGCAAA TAA
AA sequence Show only first row Show all	>Lus10043307 pacid=23167920 polypeptide=Lus10043307 locus=Lus10043307.g ID=Lus10043307.BGIv1.0 annot-version=v1.0 MICLSSSSINFGEAARLPTDDSSNCVTYQSKVPDCVTYLGSKDTDTPPQSCCTQLKKLLAPPADQLKPVCACMKPVFASNPKAGTIVTGCNAQNEVAKCK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10043307 [exp]	0	1
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10002933 [exp]	2.6	0.9731
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10029872 [exp]	5.8	0.9703
AT4G28110	MYB	ATMYB41	myb domain protein 41 (.1)		Lus10033738 [exp]	7.5	0.9684
AT5G15430			Plant calmodulin-binding prote...		Lus10000141 [exp]	7.5	0.9677
					Lus10002418 [exp]	9.2	0.9439
					Lus10015828 [exp]	9.7	0.9637
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	10.4	0.9636
AT1G11340			S-locus lectin protein kinase ...		Lus10036139 [exp]	11.2	0.9624
AT5G15430			Plant calmodulin-binding prote...		Lus10003472 [exp]	12.3	0.9623
AT2G27410	B3		Domain of unknown function (DU...		Lus10027284 [exp]	12.4	0.9603

Compare expression of checked genes

Lus10043307 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.