Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24960 157 / 2e-45 CYP71A14 "cytochrome P450, family 71, subfamily A, polypeptide 14", cytochrome P450, family 71, subfamily A, polypeptide 14 (.1) AT2G30770 155 / 2e-44 CYP71A13 cytochrome P450, family 71, subfamily A, polypeptide 13 (.1) AT3G48290 154 / 3e-44 CYP71A24 "cytochrome P450, family 71, subfamily A, polypeptide 24", cytochrome P450, family 71, subfamily A, polypeptide 24 (.1.2) AT3G48320 153 / 1e-43 CYP71A21 "cytochrome P450, family 71, subfamily A, polypeptide 21", cytochrome P450, family 71, subfamily A, polypeptide 21 (.1) AT4G13310 150 / 1e-43 CYP71A20 "cytochrome P450, family 71, subfamily A, polypeptide 20", cytochrome P450, family 71, subfamily A, polypeptide 20 (.1.2) AT5G24950 152 / 3e-43 CYP71A15 "cytochrome P450, family 71, subfamily A, polypeptide 15", cytochrome P450, family 71, subfamily A, polypeptide 15 (.1) AT2G30750 151 / 5e-43 CYP71A12 cytochrome P450, family 71, subfamily A, polypeptide 12 (.1) AT1G11610 150 / 7e-43 CYP71A18 "cytochrome P450, family 71, subfamily A, polypeptide 18", cytochrome P450, family 71, subfamily A, polypeptide 18 (.1.2) AT3G48270 149 / 3e-42 CYP71A26 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) AT4G13290 148 / 7e-42 CYP71A19 "cytochrome P450, family 71, subfamily A, polypeptide 19", cytochrome P450, family 71, subfamily A, polypeptide 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019460 [exp] 293 / 1e-101 AT3G48320 161 / 3e-47 "cytochrome P450, family 71, subfamily A, polypeptide 21", cytochrome P450, family 71, subfamily A, polypeptide 21 (.1) Lus10017961 [exp] 167 / 9e-49 AT3G48280 502 / 4e-175 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10041951 [exp] 166 / 3e-48 AT3G48280 519 / 0.0 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10019459 [exp] 164 / 1e-47 AT2G30770 409 / 3e-138 cytochrome P450, family 71, subfamily A, polypeptide 13 (.1) Lus10043310 [exp] 157 / 6e-46 AT2G30770 329 / 4e-109 cytochrome P450, family 71, subfamily A, polypeptide 13 (.1) Lus10043308 [exp] 148 / 1e-41 AT3G48280 463 / 5e-160 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10019457 [exp] 147 / 3e-41 AT3G48280 467 / 2e-161 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10029787 [exp] 144 / 3e-40 AT3G48310 407 / 7e-138 "cytochrome P450, family 71, subfamily A, polypeptide 22", cytochrome P450, family 71, subfamily A, polypeptide 22 (.1) Lus10002885 [exp] 143 / 1e-39 AT3G48280 396 / 2e-133 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G085600 [exp] 194 / 3e-59 AT3G48270 378 / 1e-126 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) Potri.016G137600 [exp] 177 / 2e-52 AT3G48270 401 / 2e-135 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) Potri.015G086000 [exp] 163 / 2e-47 AT1G13080 434 / 2e-148 "cytochrome P450, family 71, subfamily B, polypeptide 2", cytochrome P450, family 71, subfamily B, polypeptide 2 (.1.2) Potri.012G090000 [exp] 162 / 3e-47 AT3G26330 433 / 5e-148 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Potri.012G089900 [exp] 162 / 4e-47 AT3G48280 429 / 1e-146 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Potri.012G089600 [exp] 158 / 2e-45 AT3G48310 387 / 6e-130 "cytochrome P450, family 71, subfamily A, polypeptide 22", cytochrome P450, family 71, subfamily A, polypeptide 22 (.1) Potri.015G085800 [exp] 157 / 5e-45 AT3G48270 479 / 7e-166 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) Potri.011G131051 [exp] 146 / 3e-42 AT3G48280 218 / 9e-67 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Potri.001G365432 [exp] 138 / 5e-41 AT2G24180 142 / 2e-40 cytochrome p450 71b6 (.1) Potri.011G130850 [exp] 146 / 6e-41 AT3G26300 361 / 5e-120 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10043311 pacid=23167963 polypeptide=Lus10043311 locus=Lus10043311.g ID=Lus10043311.BGIv1.0 annot-version=v1.0 ATGGAGCTTCCCATGATCATTTTCCCACTCCTCTTCATAACCCCATTGTTCTTTTTCCTCCTCAAATCAAGAAGAAACTCCAACAAAACCCAACTCAACC TCCCGCCCTCACCGCCGACTCTGCCAGTCATCGGAAACCTTCACCAAGTCGGCGCCGTCCCATACCGCTCGCTCAAATCCCTCGCCGACAAGTACGGCCC CCTAATGCTCCTCCACTTCGGTAGCGCCCCCACCGTCGTCGTCTCTTCCGCGCAGGTAGCCGAACTCATCACCAGAGACCACGACGTCGTCTTCGCCGAC AGGCCACGTCTCAGCGTGGCCAACATCTTCTTCTTCGGGTGGAGCGACCTCGCCTTCTGTCCTTACGGCGAGTACTGGAGGCAGGTGAAGAAGATCTGCG TCCTCGAGCTCCTCAGCCAGAAGCGAGTCCAGGGTTTCGACTTCGTCAGGGAGGAAGAGACCGACAGTTTAGTGGCCGAGATCTCATTTGGTCGAGGAGA TCTCCGCCTCCAGCCGCCGCGGCGAATCCGTCGACCTCAGCGAGCTGCTGGTTTCGATTTCGAACAACATCGTGTCCAGATCTGCTCTGGGCCGGACTTA TACCAAGAGCGAGGATGGCGAGTTGAGCTCAGGGGATCTTGTACGGACGGCTCTGGGTTTGGTGGGTGGATTCTGCTTTAA
AA sequence Show only first row Show all	>Lus10043311 pacid=23167963 polypeptide=Lus10043311 locus=Lus10043311.g ID=Lus10043311.BGIv1.0 annot-version=v1.0 MELPMIIFPLLFITPLFFFLLKSRRNSNKTQLNLPPSPPTLPVIGNLHQVGAVPYRSLKSLADKYGPLMLLHFGSAPTVVVSSAQVAELITRDHDVVFAD RPRLSVANIFFFGWSDLAFCPYGEYWRQVKKICVLELLSQKRVQGFDFVREEETDSLVAEISFGRGDLRLQPPRRIRRPQRAAGFDFEQHRVQICSGPDL YQERGWRVELRGSCTDGSGFGGWILL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48320		CYP71A21	"cytochrome P450, family 71, s...		Lus10043311 [exp]	0	1
AT3G07310			Protein of unknown function (D...		Lus10002343 [exp]	1.4	0.9965
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10021137 [exp]	1.7	0.9958
AT2G40620	bZIP	AtbZIP18	Basic-leucine zipper (bZIP) tr...		Lus10030531 [exp]	2.0	0.9958
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10025902 [exp]	2.0	0.9963
AT1G13080		CYP71B2	"cytochrome P450, family 71, s...		Lus10043312 [exp]	3.5	0.9946
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10028898 [exp]	4.5	0.9933
AT3G26330		CYP71B37	"cytochrome P450, family 71, s...		Lus10012879 [exp]	5.0	0.9949
AT4G15560		AtCLA1, DXS, DX...	1-DEOXY-D-XYLULOSE 5-PHOSPHATE...		Lus10001322 [exp]	6.5	0.9945
AT3G48310		CYP71A22	"cytochrome P450, family 71, s...		Lus10030530 [exp]	6.9	0.9909
AT5G13080	WRKY	ATWRKY75, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10011346 [exp]	7.1	0.9908

Compare expression of checked genes

Lus10043311 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.