Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58190 75 / 2e-16 AtRLP9 receptor like protein 9 (.1.2) AT3G53240 74 / 4e-16 AtRLP45 receptor like protein 45 (.1) AT1G74190 74 / 6e-16 AtRLP15 receptor like protein 15 (.1) AT2G34930 71 / 1e-14 disease resistance family protein / LRR family protein (.1) AT4G13880 70 / 2e-14 AtRLP48 receptor like protein 48 (.1) AT1G07390 69 / 5e-14 AtRLP1 receptor like protein 1 (.1.2.3) AT3G05660 68 / 9e-14 AtRLP33 receptor like protein 33 (.1) AT3G12610 67 / 1e-13 DRT100 DNA-DAMAGE REPAIR/TOLERATION 100, Leucine-rich repeat (LRR) family protein (.1) AT5G49290 67 / 1e-13 ATRLP56 receptor like protein 56 (.1) AT1G62950 67 / 1e-13 leucine-rich repeat transmembrane protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016344 [exp] 89 / 6e-21 AT2G34930 399 / 1e-124 disease resistance family protein / LRR family protein (.1) Lus10000220 [exp] 88 / 6e-21 AT2G34930 312 / 1e-95 disease resistance family protein / LRR family protein (.1) Lus10016326 [exp] 88 / 1e-20 AT2G34930 456 / 2e-145 disease resistance family protein / LRR family protein (.1) Lus10002758 [exp] 87 / 1e-20 AT2G34930 443 / 1e-140 disease resistance family protein / LRR family protein (.1) Lus10000236 [exp] 87 / 1e-20 AT2G34930 328 / 2e-101 disease resistance family protein / LRR family protein (.1) Lus10002743 [exp] 86 / 7e-20 AT2G34930 476 / 6e-153 disease resistance family protein / LRR family protein (.1) Lus10002753 [exp] 83 / 4e-19 AT2G34930 389 / 2e-120 disease resistance family protein / LRR family protein (.1) Lus10032335 [exp] 82 / 8e-19 AT3G23110 372 / 7e-116 EMBRYO DEFECTIVE 2800, receptor like protein 37 (.1) Lus10001034 [exp] 82 / 9e-19 AT2G34930 360 / 1e-110 disease resistance family protein / LRR family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G024600 [exp] 77 / 5e-17 AT2G34930 415 / 5e-130 disease resistance family protein / LRR family protein (.1) Potri.015G025200 [exp] 77 / 5e-17 AT2G34930 414 / 7e-130 disease resistance family protein / LRR family protein (.1) Potri.015G025800 [exp] 76 / 8e-17 AT2G34930 375 / 3e-115 disease resistance family protein / LRR family protein (.1) Potri.015G028600 [exp] 75 / 4e-16 AT2G34930 387 / 1e-119 disease resistance family protein / LRR family protein (.1) Potri.001G043800 [exp] 74 / 6e-16 AT2G34930 383 / 7e-119 disease resistance family protein / LRR family protein (.1) Potri.018G145512 [exp] 73 / 1e-15 AT2G25470 338 / 5e-101 receptor like protein 21 (.1) Potri.012G019850 [exp] 72 / 2e-15 AT4G13810 309 / 2e-94 receptor like protein 47 (.1.2) Potri.001G065309 [exp] 72 / 3e-15 AT1G07390 294 / 6e-89 receptor like protein 1 (.1.2.3) Potri.012G021940 [exp] 72 / 3e-15 AT2G33060 229 / 6e-68 receptor like protein 27 (.1) Potri.001G063300 [exp] 71 / 4e-15 AT1G07390 330 / 1e-96 receptor like protein 1 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10043328 pacid=23168218 polypeptide=Lus10043328 locus=Lus10043328.g ID=Lus10043328.BGIv1.0 annot-version=v1.0 ATGACAGGAAGTATTCCACCCAGAATCGCCAGTCTGAAAGGACTATCCATGCTTAACCTGTCCCGTAATTGTTTCCCAGGAAATATTCCGGAAAACGTTG GGGACATGAGTGGTTTGGAATCTATAGACCTCAGCTTCAACAGTTTGAGCGGAGAGATTCCAAACTCATTGAACTTATTGGATGCTCTTGGAACTCTCAA CTTATCGTACAATAATCTTAGTGGGGGGATTCCTTCTGAGAGGAAGATGGACACTTTGTATGGGGATGGTTCGGGATTCGCTGTGAACAAATACCTGTGT GGTTCTCCTGGAGCGATAATCAACTGCAGCAGTAGTACTGGATTAATCCCCGAGGGAACTGGTGATGATGATGGTGATGATGAACAACTAGATTGGTTGT TGTATGTGCTGGTGACTGTGGGATATGGAGTTGGCCTCTGGGGGTTGGTTTTGTAG
AA sequence Show only first row Show all	>Lus10043328 pacid=23168218 polypeptide=Lus10043328 locus=Lus10043328.g ID=Lus10043328.BGIv1.0 annot-version=v1.0 MTGSIPPRIASLKGLSMLNLSRNCFPGNIPENVGDMSGLESIDLSFNSLSGEIPNSLNLLDALGTLNLSYNNLSGGIPSERKMDTLYGDGSGFAVNKYLC GSPGAIINCSSSTGLIPEGTGDDDGDDEQLDWLLYVLVTVGYGVGLWGLVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53240		AtRLP45	receptor like protein 45 (.1)		Lus10043328 [exp]	0	1
AT2G26730			Leucine-rich repeat protein ki...		Lus10042135 [exp]	3.2	0.6917
AT1G69630			F-box/RNI-like superfamily pro...		Lus10011410 [exp]	8.3	0.7004
					Lus10022112 [exp]	9.4	0.6932
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Lus10009144 [exp]	10.8	0.6232
AT4G20270		BAM3	BARELY ANY MERISTEM 3, Leucine...		Lus10043327 [exp]	11.8	0.6973
AT5G53480			ARM repeat superfamily protein...		Lus10014540 [exp]	11.8	0.6595
AT3G17220		ATPMEI2	pectin methylesterase inhibito...		Lus10017345 [exp]	14.4	0.6971
AT2G04305			Magnesium transporter CorA-lik...		Lus10035643 [exp]	20.0	0.6873
AT5G01180		ATPTR5	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10017177 [exp]	20.4	0.6659
AT2G15220			Plant basic secretory protein ...		Lus10013863 [exp]	21.4	0.5769

Compare expression of checked genes

Lus10043328 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.