Lus10043338 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47740 114 / 1e-30 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT5G65500 60 / 3e-10 U-box domain-containing protein kinase family protein (.1)
AT1G01680 59 / 4e-10 ATPUB54 plant U-box 54 (.1)
AT5G57035 56 / 7e-09 U-box domain-containing protein kinase family protein (.1)
AT1G16760 54 / 3e-08 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT5G12000 52 / 2e-07 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT5G61550 52 / 2e-07 U-box domain-containing protein kinase family protein (.1.2)
AT5G61560 51 / 3e-07 U-box domain-containing protein kinase family protein (.1.2)
AT1G78940 50 / 5e-07 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2)
AT4G25160 48 / 2e-06 U-box domain-containing protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019487 343 / 2e-120 AT5G47740 128 / 3e-36 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10002238 111 / 4e-29 AT5G47740 183 / 2e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10029567 110 / 6e-28 AT5G47740 187 / 4e-57 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10040825 68 / 1e-12 AT2G45910 496 / 1e-163 U-box domain-containing protein kinase family protein (.1)
Lus10016557 66 / 3e-12 AT2G45910 508 / 3e-168 U-box domain-containing protein kinase family protein (.1)
Lus10017145 54 / 3e-08 AT5G35380 207 / 3e-60 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10033340 52 / 1e-07 AT1G16760 800 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10027592 48 / 2e-06 AT3G20200 175 / 2e-50 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10008542 49 / 3e-06 AT2G24370 823 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G084700 213 / 1e-69 AT5G47740 124 / 1e-34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.015G083100 205 / 2e-66 AT5G47740 112 / 5e-30 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.006G003900 121 / 3e-33 AT5G47740 215 / 3e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.001G239100 57 / 4e-09 AT2G45910 473 / 6e-156 U-box domain-containing protein kinase family protein (.1)
Potri.009G030400 56 / 1e-08 AT2G45910 398 / 5e-126 U-box domain-containing protein kinase family protein (.1)
Potri.004G233000 53 / 8e-08 AT4G25160 874 / 0.0 U-box domain-containing protein kinase family protein (.1)
Potri.018G061600 51 / 3e-07 AT5G12000 714 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Potri.007G001900 45 / 2e-05 AT1G78940 757 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2)
Potri.006G225300 42 / 0.0003 AT5G12000 749 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10043338 pacid=23168177 polypeptide=Lus10043338 locus=Lus10043338.g ID=Lus10043338.BGIv1.0 annot-version=v1.0
ATGGAAATCGAAGGACAGTCGCCGGCGACGGGGAGCAGCAGCAGCAGCTCGTTCCAGTATAGTAAATCAAGGGTGATGTCGTCTGAAATTGTGGAGATCG
TTGATTTCGATGACAACAATATCAACAACAACAGTAGTAGTGGGATAGTGATCAATGATGTATATGTTTGTGTGGGGAGAGATGACATGGATGCTGTCAA
ATGGGCCGTCGATCATATCTCTTCCCCTCCCTCTCGTTTGTTCCTCGTCCACGTCTTCCCTCCCCTCCGCTACATCTCCACTCCAGTTGGAAGATTGGCG
AAGAACCAGCTGAGCAAAGACCAGTTGAGGTTTTACTCCAACGAGGAGAACAACAGGAGGAGGAATCTGTTGCACAAATACATTCGCTTCTGTGATGATG
CCAAGGTTCCAGTAGACACCATGTTGCTGGAGAGCGCCGAAACTGGGAAAGCCATACTTGATCTAATCCCTGTTCTCAACATCACCAATCTCGTCCTCGG
CGCAAAGCCTCCTCCTCTTCCACGCTCCAGGTTGATCAAGAGAGTCGGGAAAGCAGAATTCGTCAAGAAGAACGCGCCCGATTACTGCCAGGTAACCGTG
GTTCACAAAGGGAAGGCTTTAACTGATGGTGTTCACAGAAGAATGGCGTCATCATCATCCATTGCCAATCCTGATCAGAGGAAGTTCTTCTCCTGCGGTT
GTTTCTCTGGAAAGTTTGATAATTGA
AA sequence
>Lus10043338 pacid=23168177 polypeptide=Lus10043338 locus=Lus10043338.g ID=Lus10043338.BGIv1.0 annot-version=v1.0
MEIEGQSPATGSSSSSSFQYSKSRVMSSEIVEIVDFDDNNINNNSSSGIVINDVYVCVGRDDMDAVKWAVDHISSPPSRLFLVHVFPPLRYISTPVGRLA
KNQLSKDQLRFYSNEENNRRRNLLHKYIRFCDDAKVPVDTMLLESAETGKAILDLIPVLNITNLVLGAKPPPLPRSRLIKRVGKAEFVKKNAPDYCQVTV
VHKGKALTDGVHRRMASSSSIANPDQRKFFSCGCFSGKFDN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G47740 Adenine nucleotide alpha hydro... Lus10043338 0 1
AT5G47740 Adenine nucleotide alpha hydro... Lus10019487 1.0 0.8510
AT4G31140 O-Glycosyl hydrolases family 1... Lus10024535 5.3 0.8056
Lus10015658 7.6 0.8319
AT5G15080 Protein kinase superfamily pro... Lus10006643 7.9 0.8198
AT1G01900 SBTI1.1, ATSBT1... subtilase family protein (.1) Lus10041382 10.1 0.7976
AT5G44005 unknown protein Lus10003608 10.2 0.7967
AT1G62760 Plant invertase/pectin methyle... Lus10028910 11.5 0.7795
AT1G11080 SCPL31 serine carboxypeptidase-like 3... Lus10018467 14.1 0.7244
AT3G24330 O-Glycosyl hydrolases family 1... Lus10017740 14.4 0.7870
AT3G24330 O-Glycosyl hydrolases family 1... Lus10033082 14.7 0.7826

Lus10043338 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.