Lus10043340 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48190 136 / 1e-38 PIG1, ATATM, ATM pcd in male gametogenesis 1, ARABIDOPSIS THALIANA ATAXIA-TELANGIECTASIA MUTATED, ataxia-telangiectasia mutated (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000064 202 / 2e-68 AT3G48190 248 / 2e-76 pcd in male gametogenesis 1, ARABIDOPSIS THALIANA ATAXIA-TELANGIECTASIA MUTATED, ataxia-telangiectasia mutated (.1)
Lus10019489 183 / 6e-55 AT3G48190 3373 / 0.0 pcd in male gametogenesis 1, ARABIDOPSIS THALIANA ATAXIA-TELANGIECTASIA MUTATED, ataxia-telangiectasia mutated (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G076650 160 / 5e-47 AT3G48190 3584 / 0.0 pcd in male gametogenesis 1, ARABIDOPSIS THALIANA ATAXIA-TELANGIECTASIA MUTATED, ataxia-telangiectasia mutated (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02260 FATC FATC domain
Representative CDS sequence
>Lus10043340 pacid=23168287 polypeptide=Lus10043340 locus=Lus10043340.g ID=Lus10043340.BGIv1.0 annot-version=v1.0
ATGTTTCAGGTGTTTATTCATGATCCTTTGTATAAATGGGCGTTGTCTCCTCTGAAAGCCTTACAACGGCAAAAGGATACGGATTATGATCTGGAGACGA
GTATGGAAGACTCCGATGATCGAAGCGAGGGGAACAAGGATGCGACGCGGGCGCTACTGCGAGTGAAGCAAAAGCTAGATGGCTACGAAGAAGGGGAGCT
GAGAAGTGTGAATGGACAGGTTCAGCAACTGATTCAAGACGCTATTGATTCGGAGCGTCTGTGCCAAATGTTTCCATTGAAGGAACTTTACTTGGACAAT
TACTAA
AA sequence
>Lus10043340 pacid=23168287 polypeptide=Lus10043340 locus=Lus10043340.g ID=Lus10043340.BGIv1.0 annot-version=v1.0
MFQVFIHDPLYKWALSPLKALQRQKDTDYDLETSMEDSDDRSEGNKDATRALLRVKQKLDGYEEGELRSVNGQVQQLIQDAIDSERLCQMFPLKELYLDN
Y

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48190 PIG1, ATATM, AT... pcd in male gametogenesis 1, A... Lus10043340 0 1
AT3G48190 PIG1, ATATM, AT... pcd in male gametogenesis 1, A... Lus10000064 1.0 0.9311
AT3G48240 Octicosapeptide/Phox/Bem1p fam... Lus10043341 4.5 0.7741
AT4G36980 unknown protein Lus10019346 4.7 0.7969
AT3G48190 PIG1, ATATM, AT... pcd in male gametogenesis 1, A... Lus10043339 7.3 0.7695
AT5G44070 ATPCS1, ARA8, C... CADMIUM SENSITIVE 1, ARABIDOPS... Lus10003623 7.7 0.7757
AT2G17820 AHK1, ATHK1 histidine kinase 1 (.1) Lus10028438 8.5 0.7648
AT1G33360 ATP-dependent Clp protease (.1... Lus10040561 11.0 0.7598
AT3G55530 SDIR1 SALT- AND DROUGHT-INDUCED RING... Lus10000513 13.0 0.7671
AT3G26100 Regulator of chromosome conden... Lus10006455 13.5 0.7555
AT3G20530 Protein kinase superfamily pro... Lus10040050 15.9 0.7414

Lus10043340 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.