Lus10043341 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48240 141 / 8e-43 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G63130 126 / 8e-37 Octicosapeptide/Phox/Bem1p family protein (.1)
AT3G26510 123 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
AT1G70640 117 / 3e-33 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1)
AT4G05150 99 / 2e-24 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G49920 91 / 4e-22 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G57610 91 / 4e-21 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT2G35050 91 / 4e-21 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT3G46920 90 / 5e-21 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT2G01190 88 / 2e-20 PDE331 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019490 326 / 4e-115 AT3G48240 149 / 9e-46 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10002938 124 / 5e-36 AT3G48240 130 / 1e-38 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10026700 118 / 1e-33 AT3G26510 135 / 3e-40 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10017947 111 / 2e-31 AT5G63130 121 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10036862 105 / 9e-29 AT3G26510 122 / 3e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10006214 104 / 2e-28 AT3G26510 123 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10002588 106 / 6e-27 AT4G05150 319 / 2e-104 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10018412 99 / 2e-24 AT4G05150 304 / 1e-98 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10035641 94 / 9e-24 AT5G09620 243 / 6e-78 Octicosapeptide/Phox/Bem1p family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G083400 159 / 6e-50 AT3G48240 152 / 2e-47 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.012G085000 158 / 1e-49 AT5G63130 139 / 4e-42 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.008G186500 132 / 1e-38 AT3G26510 152 / 1e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.010G046400 124 / 2e-35 AT3G26510 152 / 5e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.004G032200 105 / 5e-27 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.011G041100 103 / 5e-26 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.001G285800 95 / 6e-23 AT5G64430 270 / 8e-85 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.003G006200 93 / 8e-23 AT5G49920 188 / 3e-58 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.006G190200 93 / 4e-22 AT3G46920 652 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Potri.009G080200 92 / 5e-22 AT5G64430 281 / 6e-89 Octicosapeptide/Phox/Bem1p family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00564 PB1 PB1 domain
Representative CDS sequence
>Lus10043341 pacid=23168079 polypeptide=Lus10043341 locus=Lus10043341.g ID=Lus10043341.BGIv1.0 annot-version=v1.0
ATGAAAACTACTCCCGCCGCAGCGTCCACCAACACTATTATTAAGTTCCTATGTAGCTACGGAGGGAAGATCGTTCCTCGTTCTAGCGACGGCAAGCTTC
GTTACCGCGGCGGACTCACAAGAGTGTTTGCTGTCCATCGTTCCGTTTCTTTTTCCGAGCTGATGGTCAAGCTGGGGGAGTTCTGTGGTGCTCAGTCGTC
CGTCGAATTGAAGTGTCAACTGCCTAACGGAGATTTGGAGACTTTGATCTCAATCAAGTCCGACGAGGAATTGGCCAACCTTTTCCAAGAATATGACCGT
TGTTGCCCCGGATCCAAAATTAGAGCGGTCCTGTCCCTGCTCAAACCGGTGTCGTCATCTCCTACTCAATCGGAGACAGCAACGAGCAATGATTCCTCTC
CTTGCAGTACCCCTGAATACTTCCGCCCATCGGCTTGCGGCTTTCACTCCCCGACGTTTGGTTACCGGGCCGGCTTCTATGGAGCTTCCGTCCAAAGCGG
CCACTACAGCCCACAGCATCCAATCGGAATTGGACAGCAGCGGAAAGTGGTCGGGCGTCGCTACAGGATTTGGAACTAA
AA sequence
>Lus10043341 pacid=23168079 polypeptide=Lus10043341 locus=Lus10043341.g ID=Lus10043341.BGIv1.0 annot-version=v1.0
MKTTPAAASTNTIIKFLCSYGGKIVPRSSDGKLRYRGGLTRVFAVHRSVSFSELMVKLGEFCGAQSSVELKCQLPNGDLETLISIKSDEELANLFQEYDR
CCPGSKIRAVLSLLKPVSSSPTQSETATSNDSSPCSTPEYFRPSACGFHSPTFGYRAGFYGASVQSGHYSPQHPIGIGQQRKVVGRRYRIWN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48240 Octicosapeptide/Phox/Bem1p fam... Lus10043341 0 1
AT3G48190 PIG1, ATATM, AT... pcd in male gametogenesis 1, A... Lus10043340 4.5 0.7741
AT1G44350 ILL6 IAA-leucine resistant (ILR)-li... Lus10025668 5.8 0.7916
AT1G64300 Protein kinase family protein ... Lus10041114 7.1 0.7425
AT2G28250 NCRK Protein kinase superfamily pro... Lus10021460 10.6 0.7775
AT3G48190 PIG1, ATATM, AT... pcd in male gametogenesis 1, A... Lus10000064 14.9 0.7501
AT3G05580 TOPP9 type one protein phosphatase 9... Lus10015192 19.8 0.7899
AT5G49900 Beta-glucosidase, GBA2 type fa... Lus10003517 22.4 0.7894
AT5G06510 CCAAT NF-YA10 "nuclear factor Y, subunit A10... Lus10021259 31.1 0.7611
AT5G43150 unknown protein Lus10010543 34.5 0.7594
AT5G52340 ATEXO70A2 exocyst subunit exo70 family p... Lus10021283 39.5 0.7443

Lus10043341 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.