Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47060 48 / 2e-08 Protein of unknown function (DUF581) (.1) AT4G17670 46 / 1e-07 Protein of unknown function (DUF581) (.1) AT2G44670 41 / 3e-06 Protein of unknown function (DUF581) (.1) AT1G22160 40 / 2e-05 Protein of unknown function (DUF581) (.1) AT5G65040 40 / 2e-05 Protein of unknown function (DUF581) (.1) AT1G78020 39 / 9e-05 Protein of unknown function (DUF581) (.1) AT1G53903 37 / 0.0002 Protein of unknown function (DUF581) (.1) AT1G53885 37 / 0.0002 Protein of unknown function (DUF581) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019494 [exp] 61 / 7e-14 AT5G47060 95 / 8e-26 Protein of unknown function (DUF581) (.1) Lus10019672 [exp] 40 / 2e-05 AT1G78020 100 / 2e-27 Protein of unknown function (DUF581) (.1) Lus10000693 [exp] 40 / 2e-05 AT1G78020 99 / 6e-27 Protein of unknown function (DUF581) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G052900 [exp] 54 / 5e-11 AT2G44670 88 / 2e-24 Protein of unknown function (DUF581) (.1) Potri.002G140300 [exp] 53 / 6e-11 AT2G44670 85 / 3e-23 Protein of unknown function (DUF581) (.1) Potri.001G148700 [exp] 49 / 5e-09 AT4G17670 142 / 5e-44 Protein of unknown function (DUF581) (.1) Potri.003G085700 [exp] 47 / 6e-08 AT4G17670 140 / 2e-43 Protein of unknown function (DUF581) (.1) Potri.002G092900 [exp] 39 / 4e-05 AT1G22160 137 / 5e-42 Protein of unknown function (DUF581) (.1) Potri.005G168900 [exp] 39 / 4e-05 AT1G22160 142 / 2e-44 Protein of unknown function (DUF581) (.1) Potri.005G078600 [exp] 39 / 0.0001 AT1G78020 106 / 3e-29 Protein of unknown function (DUF581) (.1) Potri.001G163400 [exp] 37 / 0.0003 AT1G53903 113 / 5e-33 Protein of unknown function (DUF581) (.1) Potri.003G071900 [exp] 36 / 0.0007 AT1G53903 108 / 4e-31 Protein of unknown function (DUF581) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0175 [flax] [poplar] TRASH PF04570 [flax] [poplar] zf-FLZ zinc-finger of the FCS-type, C2-C2
Representative CDS sequence Show only first row Show all	>Lus10043343 pacid=23167914 polypeptide=Lus10043343 locus=Lus10043343.g ID=Lus10043343.BGIv1.0 annot-version=v1.0 ATGTACAGAGGGAATACTCCTTTCTGTAGCAAGGAGTGCAGGCAGGAGCAAATAGAGGTTGACGAATCCAGCGAGATGATGACAGCGACGGCCTGGAAGA AGAAGAAGAAGAAGTCGCTTCTTCCTTCTTCCTCTGCTAATAGTAGTACTAGATCTGCGGTTACTTCTCCATCTTCTGCTTCCACCAAAGCTGTACGGAC TGGCACGGTTGCCGTTGCTTAA
AA sequence Show only first row Show all	>Lus10043343 pacid=23167914 polypeptide=Lus10043343 locus=Lus10043343.g ID=Lus10043343.BGIv1.0 annot-version=v1.0 MYRGNTPFCSKECRQEQIEVDESSEMMTATAWKKKKKKSLLPSSSANSSTRSAVTSPSSASTKAVRTGTVAVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47060			Protein of unknown function (D...		Lus10043343 [exp]	0	1
AT5G51780	bHLH	bHLH036	basic helix-loop-helix (bHLH) ...		Lus10031677 [exp]	1.7	0.9314
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10022883 [exp]	2.8	0.9275
AT5G58110			chaperone binding;ATPase activ...		Lus10040580 [exp]	3.7	0.8973
AT1G75540	CO	LHUS, AtBBX21, ...	long hypocotyl under shade, B-...		Lus10033184 [exp]	4.1	0.8936
AT5G51780	bHLH	bHLH036	basic helix-loop-helix (bHLH) ...		Lus10031676 [exp]	4.2	0.9237
AT2G42760			unknown protein		Lus10005429 [exp]	4.5	0.9217
AT2G25280			unknown protein		Lus10001925 [exp]	5.0	0.8835
AT1G10740			alpha/beta-Hydrolases superfam...		Lus10030904 [exp]	5.0	0.9206
AT3G50830		ATCOR413-PM2, C...	cold-regulated 413-plasma memb...		Lus10012034 [exp]	5.7	0.8961
AT2G37240			Thioredoxin superfamily protei...		Lus10029111 [exp]	5.9	0.9128

Compare expression of checked genes

Lus10043343 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.